diff --git a/.github/workflows/development.yml b/.github/workflows/development.yml index 4d00e0ec..ff8c1ce4 100644 --- a/.github/workflows/development.yml +++ b/.github/workflows/development.yml @@ -16,7 +16,7 @@ jobs: test-build-upload: strategy: matrix: - go-version: [1.18.x] + go-version: [1.20.x] platform: [ubuntu-latest] runs-on: ${{ matrix.platform }} steps: @@ -39,19 +39,19 @@ jobs: CGO_ENABLED=0 GOOS=windows GOARCH=amd64 go build -ldflags "-s -X github.com/42wim/matterbridge/version.GitHash=$(git log --pretty=format:'%h' -n 1)" -o output/win/matterbridge-$VERSION-windows-amd64.exe CGO_ENABLED=0 GOOS=darwin GOARCH=amd64 go build -ldflags "-s -X github.com/42wim/matterbridge/version.GitHash=$(git log --pretty=format:'%h' -n 1)" -o output/mac/matterbridge-$VERSION-darwin-amd64 - name: Upload linux 64-bit - if: startsWith(matrix.go-version,'1.18') + if: startsWith(matrix.go-version,'1.20') uses: actions/upload-artifact@v2 with: name: matterbridge-linux-64bit path: output/lin - name: Upload windows 64-bit - if: startsWith(matrix.go-version,'1.18') + if: startsWith(matrix.go-version,'1.20') uses: actions/upload-artifact@v2 with: name: matterbridge-windows-64bit path: output/win - name: Upload darwin 64-bit - if: startsWith(matrix.go-version,'1.18') + if: startsWith(matrix.go-version,'1.20') uses: actions/upload-artifact@v2 with: name: matterbridge-darwin-64bit diff --git a/README.md b/README.md index dd166457..cc04db3d 100644 --- a/README.md +++ b/README.md @@ -114,6 +114,7 @@ And more... ### 3rd party via matterbridge api +- [Delta Chat](https://github.com/deltachat-bot/matterdelta) - [Discourse](https://github.com/DeclanHoare/matterbabble) - [Facebook messenger](https://github.com/powerjungle/fbridge-asyncio) - [Facebook messenger](https://github.com/VictorNine/fbridge) diff --git a/bridge/telegram/handlers.go b/bridge/telegram/handlers.go index b9cc7e6f..5ffb1eca 100644 --- a/bridge/telegram/handlers.go +++ b/bridge/telegram/handlers.go @@ -128,7 +128,9 @@ func (b *Btelegram) handleUsername(rmsg *config.Message, message *tgbotapi.Messa rmsg.Username = message.From.FirstName } if b.GetBool("UseFullName") { - rmsg.Username = message.From.FirstName + " " + message.From.LastName + if message.From.FirstName != "" && message.From.LastName != "" { + rmsg.Username = message.From.FirstName + " " + message.From.LastName + } } if rmsg.Username == "" { rmsg.Username = message.From.UserName @@ -148,7 +150,9 @@ func (b *Btelegram) handleUsername(rmsg *config.Message, message *tgbotapi.Messa rmsg.Username = message.SenderChat.FirstName } if b.GetBool("UseFullName") { - rmsg.Username = message.SenderChat.FirstName + " " + message.SenderChat.LastName + if message.SenderChat.FirstName != "" && message.SenderChat.LastName != "" { + rmsg.Username = message.SenderChat.FirstName + " " + message.SenderChat.LastName + } } if rmsg.Username == "" || rmsg.Username == "Channel_Bot" { @@ -164,6 +168,11 @@ func (b *Btelegram) handleUsername(rmsg *config.Message, message *tgbotapi.Messa } } + // Fallback on author signature (used in "channel" type of chat) + if rmsg.Username == "" && message.AuthorSignature != "" { + rmsg.Username = message.AuthorSignature + } + // if we really didn't find a username, set it to unknown if rmsg.Username == "" { rmsg.Username = unknownUser diff --git a/bridge/whatsappmulti/handlers.go b/bridge/whatsappmulti/handlers.go index d860b38d..d99c6727 100644 --- a/bridge/whatsappmulti/handlers.go +++ b/bridge/whatsappmulti/handlers.go @@ -66,6 +66,10 @@ func (b *Bwhatsapp) handleTextMessage(messageInfo types.MessageInfo, msg *proto. // nolint:nestif if msg.GetExtendedTextMessage() == nil { text = msg.GetConversation() + } else if msg.GetExtendedTextMessage().GetContextInfo() == nil { + // Handle pure text message with a link preview + // A pure text message with a link preview acts as an extended text message but will not contain any context info + text = msg.GetExtendedTextMessage().GetText() } else { text = msg.GetExtendedTextMessage().GetText() ci := msg.GetExtendedTextMessage().GetContextInfo() @@ -88,6 +92,12 @@ func (b *Bwhatsapp) handleTextMessage(messageInfo types.MessageInfo, msg *proto. } } + parentID := "" + if msg.GetExtendedTextMessage() != nil { + ci := msg.GetExtendedTextMessage().GetContextInfo() + parentID = getParentIdFromCtx(ci) + } + rmsg := config.Message{ UserID: senderJID.String(), Username: senderName, @@ -96,8 +106,8 @@ func (b *Bwhatsapp) handleTextMessage(messageInfo types.MessageInfo, msg *proto. Account: b.Account, Protocol: b.Protocol, Extra: make(map[string][]interface{}), - // ParentID: TODO, // TODO handle thread replies // map from Info.QuotedMessageID string - ID: messageInfo.ID, + ID: getMessageIdFormat(senderJID, messageInfo.ID), + ParentID: parentID, } if avatarURL, exists := b.userAvatars[senderJID.String()]; exists { @@ -129,7 +139,8 @@ func (b *Bwhatsapp) handleImageMessage(msg *events.Message) { Account: b.Account, Protocol: b.Protocol, Extra: make(map[string][]interface{}), - ID: msg.Info.ID, + ID: getMessageIdFormat(senderJID, msg.Info.ID), + ParentID: getParentIdFromCtx(ci), } if avatarURL, exists := b.userAvatars[senderJID.String()]; exists { @@ -192,7 +203,8 @@ func (b *Bwhatsapp) handleVideoMessage(msg *events.Message) { Account: b.Account, Protocol: b.Protocol, Extra: make(map[string][]interface{}), - ID: msg.Info.ID, + ID: getMessageIdFormat(senderJID, msg.Info.ID), + ParentID: getParentIdFromCtx(ci), } if avatarURL, exists := b.userAvatars[senderJID.String()]; exists { @@ -210,7 +222,16 @@ func (b *Bwhatsapp) handleVideoMessage(msg *events.Message) { fileExt = append(fileExt, ".mp4") } - filename := fmt.Sprintf("%v%v", msg.Info.ID, fileExt[0]) + // Prefer .mp4 extension, otherwise fallback to first index + fileExtIndex := 0 + for i, n := range fileExt { + if ".mp4" == n { + fileExtIndex = i + break + } + } + + filename := fmt.Sprintf("%v%v", msg.Info.ID, fileExt[fileExtIndex]) b.Log.Debugf("Trying to download %s with size %#v and type %s", filename, imsg.GetFileLength(), imsg.GetMimetype()) @@ -241,7 +262,6 @@ func (b *Bwhatsapp) handleAudioMessage(msg *events.Message) { if senderJID == (types.JID{}) && ci.Participant != nil { senderJID = types.NewJID(ci.GetParticipant(), types.DefaultUserServer) } - rmsg := config.Message{ UserID: senderJID.String(), Username: senderName, @@ -249,7 +269,8 @@ func (b *Bwhatsapp) handleAudioMessage(msg *events.Message) { Account: b.Account, Protocol: b.Protocol, Extra: make(map[string][]interface{}), - ID: msg.Info.ID, + ID: getMessageIdFormat(senderJID, msg.Info.ID), + ParentID: getParentIdFromCtx(ci), } if avatarURL, exists := b.userAvatars[senderJID.String()]; exists { @@ -306,7 +327,8 @@ func (b *Bwhatsapp) handleDocumentMessage(msg *events.Message) { Account: b.Account, Protocol: b.Protocol, Extra: make(map[string][]interface{}), - ID: msg.Info.ID, + ID: getMessageIdFormat(senderJID, msg.Info.ID), + ParentID: getParentIdFromCtx(ci), } if avatarURL, exists := b.userAvatars[senderJID.String()]; exists { diff --git a/bridge/whatsappmulti/helpers.go b/bridge/whatsappmulti/helpers.go index 75d9f5fd..963eafa1 100644 --- a/bridge/whatsappmulti/helpers.go +++ b/bridge/whatsappmulti/helpers.go @@ -7,7 +7,10 @@ import ( "fmt" "strings" + goproto "google.golang.org/protobuf/proto" + "go.mau.fi/whatsmeow" + "go.mau.fi/whatsmeow/binary/proto" "go.mau.fi/whatsmeow/store" "go.mau.fi/whatsmeow/store/sqlstore" "go.mau.fi/whatsmeow/types" @@ -122,3 +125,63 @@ func (b *Bwhatsapp) getDevice() (*store.Device, error) { return device, nil } + +func (b *Bwhatsapp) getNewReplyContext(parentID string) (*proto.ContextInfo, error) { + replyInfo, err := b.parseMessageID(parentID) + + if err != nil { + return nil, err + } + + sender := fmt.Sprintf("%s@%s", replyInfo.Sender.User, replyInfo.Sender.Server) + ctx := &proto.ContextInfo{ + StanzaId: &replyInfo.MessageID, + Participant: &sender, + QuotedMessage: &proto.Message{Conversation: goproto.String("")}, + } + + return ctx, nil +} + +func (b *Bwhatsapp) parseMessageID(id string) (*Replyable, error) { + // No message ID in case action is executed on a message sent before the bridge was started + // and then the bridge cache doesn't have this message ID mapped + if id == "" { + return &Replyable{MessageID: id}, nil + } + + replyInfo := strings.Split(id, "/") + + if len(replyInfo) == 2 { + sender, err := types.ParseJID(replyInfo[0]) + + if err == nil { + return &Replyable{ + MessageID: types.MessageID(replyInfo[1]), + Sender: sender, + }, nil + } + } + + err := fmt.Errorf("MessageID does not match format of {senderJID}:{messageID} : \"%s\"", id) + + return &Replyable{MessageID: id}, err +} + +func getParentIdFromCtx(ci *proto.ContextInfo) string { + if ci != nil && ci.StanzaId != nil { + senderJid, err := types.ParseJID(*ci.Participant) + + if err == nil { + return getMessageIdFormat(senderJid, *ci.StanzaId) + } + } + + return "" +} + +func getMessageIdFormat(jid types.JID, messageID string) string { + // we're crafting our own JID str as AD JID format messes with how stuff looks on a webclient + jidStr := fmt.Sprintf("%s@%s", jid.User, jid.Server) + return fmt.Sprintf("%s/%s", jidStr, messageID) +} diff --git a/bridge/whatsappmulti/whatsapp.go b/bridge/whatsappmulti/whatsapp.go index 76e4ae46..e943fc86 100644 --- a/bridge/whatsappmulti/whatsapp.go +++ b/bridge/whatsappmulti/whatsapp.go @@ -35,11 +35,17 @@ const ( type Bwhatsapp struct { *bridge.Config - startedAt time.Time - wc *whatsmeow.Client - contacts map[types.JID]types.ContactInfo - users map[string]types.ContactInfo - userAvatars map[string]string + startedAt time.Time + wc *whatsmeow.Client + contacts map[types.JID]types.ContactInfo + users map[string]types.ContactInfo + userAvatars map[string]string + joinedGroups []*types.GroupInfo +} + +type Replyable struct { + MessageID types.MessageID + Sender types.JID } // New Create a new WhatsApp bridge. This will be called for each [whatsapp.] entry you have in the config file @@ -121,6 +127,11 @@ func (b *Bwhatsapp) Connect() error { return errors.New("failed to get contacts: " + err.Error()) } + b.joinedGroups, err = b.wc.GetJoinedGroups() + if err != nil { + return errors.New("failed to get list of joined groups: " + err.Error()) + } + b.startedAt = time.Now() // map all the users @@ -166,11 +177,6 @@ func (b *Bwhatsapp) Disconnect() error { func (b *Bwhatsapp) JoinChannel(channel config.ChannelInfo) error { byJid := isGroupJid(channel.Name) - groups, err := b.wc.GetJoinedGroups() - if err != nil { - return err - } - // verify if we are member of the given group if byJid { gJID, err := types.ParseJID(channel.Name) @@ -178,7 +184,7 @@ func (b *Bwhatsapp) JoinChannel(channel config.ChannelInfo) error { return err } - for _, group := range groups { + for _, group := range b.joinedGroups { if group.JID == gJID { return nil } @@ -187,7 +193,7 @@ func (b *Bwhatsapp) JoinChannel(channel config.ChannelInfo) error { foundGroups := []string{} - for _, group := range groups { + for _, group := range b.joinedGroups { if group.Name == channel.Name { foundGroups = append(foundGroups, group.Name) } @@ -196,7 +202,7 @@ func (b *Bwhatsapp) JoinChannel(channel config.ChannelInfo) error { switch len(foundGroups) { case 0: // didn't match any group - print out possibilites - for _, group := range groups { + for _, group := range b.joinedGroups { b.Log.Infof("%s %s", group.JID, group.Name) } return fmt.Errorf("please specify group's JID from the list above instead of the name '%s'", channel.Name) @@ -222,6 +228,10 @@ func (b *Bwhatsapp) PostDocumentMessage(msg config.Message, filetype string) (st // Post document message var message proto.Message + var ctx *proto.ContextInfo + if msg.ParentID != "" { + ctx, _ = b.getNewReplyContext(msg.ParentID) + } message.DocumentMessage = &proto.DocumentMessage{ Title: &fi.Name, @@ -233,6 +243,7 @@ func (b *Bwhatsapp) PostDocumentMessage(msg config.Message, filetype string) (st FileSha256: resp.FileSHA256, FileLength: goproto.Uint64(resp.FileLength), Url: &resp.URL, + ContextInfo: ctx, } b.Log.Debugf("=> Sending %#v as a document", msg) @@ -246,8 +257,6 @@ func (b *Bwhatsapp) PostDocumentMessage(msg config.Message, filetype string) (st // Post an image message from the bridge to WhatsApp // Handle, for sure image/jpeg, image/png and image/gif MIME types func (b *Bwhatsapp) PostImageMessage(msg config.Message, filetype string) (string, error) { - groupJID, _ := types.ParseJID(msg.Channel) - fi := msg.Extra["file"][0].(config.FileInfo) caption := msg.Username + fi.Comment @@ -258,6 +267,10 @@ func (b *Bwhatsapp) PostImageMessage(msg config.Message, filetype string) (strin } var message proto.Message + var ctx *proto.ContextInfo + if msg.ParentID != "" { + ctx, _ = b.getNewReplyContext(msg.ParentID) + } message.ImageMessage = &proto.ImageMessage{ Mimetype: &filetype, @@ -267,20 +280,16 @@ func (b *Bwhatsapp) PostImageMessage(msg config.Message, filetype string) (strin FileSha256: resp.FileSHA256, FileLength: goproto.Uint64(resp.FileLength), Url: &resp.URL, + ContextInfo: ctx, } b.Log.Debugf("=> Sending %#v as an image", msg) - ID := whatsmeow.GenerateMessageID() - _, err = b.wc.SendMessage(context.TODO(), groupJID, &message, whatsmeow.SendRequestExtra{ID: ID}) - - return ID, err + return b.sendMessage(msg, &message) } // Post a video message from the bridge to WhatsApp func (b *Bwhatsapp) PostVideoMessage(msg config.Message, filetype string) (string, error) { - groupJID, _ := types.ParseJID(msg.Channel) - fi := msg.Extra["file"][0].(config.FileInfo) caption := msg.Username + fi.Comment @@ -291,6 +300,10 @@ func (b *Bwhatsapp) PostVideoMessage(msg config.Message, filetype string) (strin } var message proto.Message + var ctx *proto.ContextInfo + if msg.ParentID != "" { + ctx, _ = b.getNewReplyContext(msg.ParentID) + } message.VideoMessage = &proto.VideoMessage{ Mimetype: &filetype, @@ -300,14 +313,12 @@ func (b *Bwhatsapp) PostVideoMessage(msg config.Message, filetype string) (strin FileSha256: resp.FileSHA256, FileLength: goproto.Uint64(resp.FileLength), Url: &resp.URL, + ContextInfo: ctx, } b.Log.Debugf("=> Sending %#v as a video", msg) - ID := whatsmeow.GenerateMessageID() - _, err = b.wc.SendMessage(context.TODO(), groupJID, &message, whatsmeow.SendRequestExtra{ID: ID}) - - return ID, err + return b.sendMessage(msg, &message) } // Post audio inline @@ -322,6 +333,10 @@ func (b *Bwhatsapp) PostAudioMessage(msg config.Message, filetype string) (strin } var message proto.Message + var ctx *proto.ContextInfo + if msg.ParentID != "" { + ctx, _ = b.getNewReplyContext(msg.ParentID) + } message.AudioMessage = &proto.AudioMessage{ Mimetype: &filetype, @@ -330,12 +345,12 @@ func (b *Bwhatsapp) PostAudioMessage(msg config.Message, filetype string) (strin FileSha256: resp.FileSHA256, FileLength: goproto.Uint64(resp.FileLength), Url: &resp.URL, + ContextInfo: ctx, } b.Log.Debugf("=> Sending %#v as audio", msg) - ID := whatsmeow.GenerateMessageID() - _, err = b.wc.SendMessage(context.TODO(), groupJID, &message, whatsmeow.SendRequestExtra{ID: ID}) + ID, err := b.sendMessage(msg, &message) var captionMessage proto.Message caption := msg.Username + fi.Comment + "\u2B06" // the char on the end is upwards arrow emoji @@ -351,6 +366,9 @@ func (b *Bwhatsapp) PostAudioMessage(msg config.Message, filetype string) (strin func (b *Bwhatsapp) Send(msg config.Message) (string, error) { groupJID, _ := types.ParseJID(msg.Channel) + extendedMsgID, _ := b.parseMessageID(msg.ID) + msg.ID = extendedMsgID.MessageID + b.Log.Debugf("=> Receiving %#v", msg) // Delete message @@ -400,14 +418,35 @@ func (b *Bwhatsapp) Send(msg config.Message) (string, error) { } } + var message proto.Message text := msg.Username + msg.Text - var message proto.Message + // If we have a parent ID send an extended message + if msg.ParentID != "" { + replyContext, err := b.getNewReplyContext(msg.ParentID) + + if err == nil { + message = proto.Message{ + ExtendedTextMessage: &proto.ExtendedTextMessage{ + Text: &text, + ContextInfo: replyContext, + }, + } + + return b.sendMessage(msg, &message) + } + } message.Conversation = &text - ID := whatsmeow.GenerateMessageID() - _, err := b.wc.SendMessage(context.TODO(), groupJID, &message, whatsmeow.SendRequestExtra{ID: ID}) - - return ID, err + return b.sendMessage(msg, &message) +} + +func (b *Bwhatsapp) sendMessage(rmsg config.Message, message *proto.Message) (string, error) { + groupJID, _ := types.ParseJID(rmsg.Channel) + ID := whatsmeow.GenerateMessageID() + + _, err := b.wc.SendMessage(context.Background(), groupJID, message, whatsmeow.SendRequestExtra{ID: ID}) + + return getMessageIdFormat(*b.wc.Store.ID, ID), err } diff --git a/go.mod b/go.mod index 4bd1808d..f4e31db3 100644 --- a/go.mod +++ b/go.mod @@ -6,29 +6,29 @@ require ( github.com/Benau/tgsconverter v0.0.0-20210809170556-99f4a4f6337f github.com/Philipp15b/go-steam v1.0.1-0.20200727090957-6ae9b3c0a560 github.com/Rhymen/go-whatsapp v0.1.2-0.20211102134409-31a2e740845c - github.com/SevereCloud/vksdk/v2 v2.15.0 + github.com/SevereCloud/vksdk/v2 v2.16.0 github.com/bwmarrin/discordgo v0.27.0 github.com/d5/tengo/v2 v2.13.0 github.com/davecgh/go-spew v1.1.1 github.com/fsnotify/fsnotify v1.6.0 github.com/go-telegram-bot-api/telegram-bot-api/v5 v5.5.1 github.com/gomarkdown/markdown v0.0.0-20221013030248-663e2500819c - github.com/google/gops v0.3.26 + github.com/google/gops v0.3.27 github.com/gorilla/schema v1.2.0 github.com/gorilla/websocket v1.5.0 github.com/harmony-development/shibshib v0.0.0-20220101224523-c98059d09cfa github.com/hashicorp/golang-lru v0.6.0 github.com/jpillora/backoff v1.0.0 github.com/keybase/go-keybase-chat-bot v0.0.0-20221220212439-e48d9abd2c20 - github.com/kyokomi/emoji/v2 v2.2.11 - github.com/labstack/echo/v4 v4.10.0 + github.com/kyokomi/emoji/v2 v2.2.12 + github.com/labstack/echo/v4 v4.10.2 github.com/lrstanley/girc v0.0.0-20221222153823-a92667a5c9b4 github.com/matterbridge/Rocket.Chat.Go.SDK v0.0.0-20211016222428-79310a412696 github.com/matterbridge/go-xmpp v0.0.0-20211030125215-791a06c5f1be github.com/matterbridge/gomatrix v0.0.0-20220411225302-271e5088ea27 github.com/matterbridge/gozulipbot v0.0.0-20211023205727-a19d6c1f3b75 github.com/matterbridge/logrus-prefixed-formatter v0.5.3-0.20200523233437-d971309a77ba - github.com/matterbridge/matterclient v0.0.0-20220624224459-272af20c7ddf + github.com/matterbridge/matterclient v0.0.0-20221106190440-8bcf49695e0d github.com/mattermost/mattermost-server/v5 v5.39.3 github.com/mattermost/mattermost-server/v6 v6.7.2 github.com/mattn/godown v0.0.1 @@ -47,15 +47,15 @@ require ( github.com/writeas/go-strip-markdown v2.0.1+incompatible github.com/yaegashi/msgraph.go v0.1.4 github.com/zfjagann/golang-ring v0.0.0-20220330170733-19bcea1b6289 - go.mau.fi/whatsmeow v0.0.0-20230128195103-dcbc8dd31a22 - golang.org/x/image v0.3.0 - golang.org/x/oauth2 v0.4.0 - golang.org/x/text v0.6.0 + go.mau.fi/whatsmeow v0.0.0-20230306190159-5caded34a872 + golang.org/x/image v0.6.0 + golang.org/x/oauth2 v0.6.0 + golang.org/x/text v0.8.0 gomod.garykim.dev/nc-talk v0.3.0 - google.golang.org/protobuf v1.28.1 + google.golang.org/protobuf v1.29.0 gopkg.in/olahol/melody.v1 v1.0.0-20170518105555-d52139073376 layeh.com/gumble v0.0.0-20221205141517-d1df60a3cc14 - modernc.org/sqlite v1.20.3 + modernc.org/sqlite v1.21.0 ) require ( @@ -80,8 +80,8 @@ require ( github.com/json-iterator/go v1.1.12 // indirect github.com/kballard/go-shellquote v0.0.0-20180428030007-95032a82bc51 // indirect github.com/kettek/apng v0.0.0-20191108220231-414630eed80f // indirect - github.com/klauspost/compress v1.15.8 // indirect - github.com/klauspost/cpuid/v2 v2.0.12 // indirect + github.com/klauspost/compress v1.16.0 // indirect + github.com/klauspost/cpuid/v2 v2.2.3 // indirect github.com/labstack/gommon v0.4.0 // indirect github.com/magiconair/properties v1.8.7 // indirect github.com/mattermost/go-i18n v1.11.1-0.20211013152124-5c415071e404 // indirect @@ -89,7 +89,7 @@ require ( github.com/mattermost/logr v1.0.13 // indirect github.com/mattermost/logr/v2 v2.0.15 // indirect github.com/mattn/go-colorable v0.1.13 // indirect - github.com/mattn/go-isatty v0.0.16 // indirect + github.com/mattn/go-isatty v0.0.17 // indirect github.com/mattn/go-runewidth v0.0.13 // indirect github.com/mgutz/ansi v0.0.0-20200706080929-d51e80ef957d // indirect github.com/minio/md5-simd v1.1.2 // indirect @@ -109,7 +109,7 @@ require ( github.com/philhofer/fwd v1.1.1 // indirect github.com/pkg/errors v0.9.1 // indirect github.com/pmezard/go-difflib v1.0.0 // indirect - github.com/remyoudompheng/bigfft v0.0.0-20200410134404-eec4a21b6bb0 // indirect + github.com/remyoudompheng/bigfft v0.0.0-20230129092748-24d4a6f8daec // indirect github.com/rickb777/date v1.12.4 // indirect github.com/rickb777/plural v1.2.0 // indirect github.com/rivo/uniseg v0.2.0 // indirect @@ -133,13 +133,13 @@ require ( go.uber.org/atomic v1.9.0 // indirect go.uber.org/multierr v1.8.0 // indirect go.uber.org/zap v1.21.0 // indirect - golang.org/x/crypto v0.4.0 // indirect - golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4 // indirect - golang.org/x/net v0.5.0 // indirect - golang.org/x/sys v0.4.0 // indirect - golang.org/x/term v0.4.0 // indirect - golang.org/x/time v0.2.0 // indirect - golang.org/x/tools v0.1.12 // indirect + golang.org/x/crypto v0.6.0 // indirect + golang.org/x/mod v0.8.0 // indirect + golang.org/x/net v0.8.0 // indirect + golang.org/x/sys v0.6.0 // indirect + golang.org/x/term v0.6.0 // indirect + golang.org/x/time v0.3.0 // indirect + golang.org/x/tools v0.6.0 // indirect google.golang.org/appengine v1.6.7 // indirect gopkg.in/ini.v1 v1.67.0 // indirect gopkg.in/natefinch/lumberjack.v2 v2.0.0 // indirect @@ -148,9 +148,9 @@ require ( lukechampine.com/uint128 v1.2.0 // indirect modernc.org/cc/v3 v3.40.0 // indirect modernc.org/ccgo/v3 v3.16.13 // indirect - modernc.org/libc v1.22.2 // indirect + modernc.org/libc v1.22.3 // indirect modernc.org/mathutil v1.5.0 // indirect - modernc.org/memory v1.4.0 // indirect + modernc.org/memory v1.5.0 // indirect modernc.org/opt v0.1.3 // indirect modernc.org/strutil v1.1.3 // indirect modernc.org/token v1.0.1 // indirect diff --git a/go.sum b/go.sum index f68ae47f..af479145 100644 --- a/go.sum +++ b/go.sum @@ -148,8 +148,8 @@ github.com/Rhymen/go-whatsapp v0.1.2-0.20211102134409-31a2e740845c/go.mod h1:DNS github.com/RoaringBitmap/roaring v0.4.23/go.mod h1:D0gp8kJQgE1A4LQ5wFLggQEyvDi06Mq5mKs52e1TwOo= github.com/RoaringBitmap/roaring v0.8.0/go.mod h1:jdT9ykXwHFNdJbEtxePexlFYH9LXucApeS0/+/g+p1I= github.com/RoaringBitmap/roaring v0.9.4/go.mod h1:icnadbWcNyfEHlYdr+tDlOTih1Bf/h+rzPpv4sbomAA= -github.com/SevereCloud/vksdk/v2 v2.15.0 h1:ywyJvuJzN1sD5+GVcYendwNTpK3R/iBZOlOhulyI9ZQ= -github.com/SevereCloud/vksdk/v2 v2.15.0/go.mod h1:0Q20DuofWA78Vdy6aPjZAM6ep1UR6uVEf/fCqdmBYaY= +github.com/SevereCloud/vksdk/v2 v2.16.0 h1:DQ90qqwY/yF1X/SWZQs1kQ/Ik+tphK82d+S6Rch46wQ= +github.com/SevereCloud/vksdk/v2 v2.16.0/go.mod h1:VN6BH9nFUXcP7Uf0uX74Aht2DQ7+139aG3/Og+jia4w= github.com/Shopify/goreferrer v0.0.0-20181106222321-ec9c9a553398/go.mod h1:a1uqRtAwp2Xwc6WNPJEufxJ7fx3npB4UV/JOLmbu5I0= github.com/Shopify/logrus-bugsnag v0.0.0-20171204204709-577dee27f20d/go.mod h1:HI8ITrYtUY+O+ZhtlqUnD8+KwNPOyugEhfP9fdUIaEQ= github.com/Shopify/sarama v1.19.0/go.mod h1:FVkBWblsNy7DGZRfXLU0O9RCGt5g3g3yEuWXgklEdEo= @@ -435,7 +435,6 @@ github.com/cpuguy83/go-md2man v1.0.10/go.mod h1:SmD6nW6nTyfqj6ABTjUi3V3JVMnlJmwc github.com/cpuguy83/go-md2man/v2 v2.0.0-20190314233015-f79a8a8ca69d/go.mod h1:maD7wRr/U5Z6m/iR4s+kqSMx2CaBsrgA7czyZG/E6dU= github.com/cpuguy83/go-md2man/v2 v2.0.0/go.mod h1:maD7wRr/U5Z6m/iR4s+kqSMx2CaBsrgA7czyZG/E6dU= github.com/cpuguy83/go-md2man/v2 v2.0.1/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= -github.com/cpuguy83/go-md2man/v2 v2.0.2/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= github.com/creack/pty v1.1.7/go.mod h1:lj5s0c3V2DBrqTV7llrYr5NG6My20zk30Fl46Y7DoTY= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= github.com/creack/pty v1.1.11/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= @@ -585,7 +584,6 @@ github.com/go-logfmt/logfmt v0.5.1/go.mod h1:WYhtIu8zTZfxdn5+rREduYbwxfcBr/Vr6KE github.com/go-logr/logr v0.1.0/go.mod h1:ixOQHD9gLJUVQQ2ZOR7zLEifBX6tGkNJF4QyIY7sIas= github.com/go-logr/logr v0.2.0/go.mod h1:z6/tIYblkpsD+a4lm/fGIIU9mZ+XfAiaFtq7xTgseGU= github.com/go-martini/martini v0.0.0-20170121215854-22fa46961aab/go.mod h1:/P9AEU963A2AYjv4d1V5eVL1CQbEJq6aCNHDDjibzu8= -github.com/go-ole/go-ole v1.2.6/go.mod h1:pprOEPIfldk/42T2oK7lQ4v4JSDwmV0As9GaiUsvbm0= github.com/go-openapi/jsonpointer v0.19.2/go.mod h1:3akKfEdA7DF1sugOqz1dVQHBcuDBPKZGEoHC/NkiQRg= github.com/go-openapi/jsonpointer v0.19.3/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg= github.com/go-openapi/jsonreference v0.19.2/go.mod h1:jMjeRr2HHw6nAVajTXJ4eiUwohSTlpa0o73RUL1owJc= @@ -729,14 +727,13 @@ github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.6/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.7/go.mod h1:n+brtR0CgQNWTVd5ZUFpTBC8YFBDLK/h/bpaJ8/DtOE= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= -github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/go-github v17.0.0+incompatible/go.mod h1:zLgOLi98H3fifZn+44m+umXrS52loVEgC2AApnigrVQ= github.com/google/go-github/v35 v35.2.0/go.mod h1:s0515YVTI+IMrDoy9Y4pHt9ShGpzHvHO8rZ7L7acgvs= github.com/google/go-querystring v1.0.0/go.mod h1:odCYkC5MyYFN7vkCjXpyrEuKhc/BUO6wN/zVPAxq5ck= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= github.com/google/gofuzz v1.1.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= -github.com/google/gops v0.3.26 h1:Ziyfd8sEhWVbrCIy59c1WOKodI63Jzojwm0JSZbBPS4= -github.com/google/gops v0.3.26/go.mod h1:vZ68aOXu2zJoybPyGpaHMmrCyd51DCxJoex4cO3ht/o= +github.com/google/gops v0.3.27 h1:BDdWfedShsBbeatZ820oA4DbVOC8yJ4NI8xAlDFWfgI= +github.com/google/gops v0.3.27/go.mod h1:lYqabmfnq4Q6UumWNx96Hjup5BDAVc8zmfIy0SkNCSk= github.com/google/martian v2.1.0+incompatible/go.mod h1:9I4somxYTbIHy5NJKHRl3wXiIaQGbYVAs8BPL6v8lEs= github.com/google/martian/v3 v3.0.0/go.mod h1:y5Zk1BBys9G+gd6Jrk0W3cC1+ELVxBWuIGO+w/tUAp0= github.com/google/martian/v3 v3.1.0/go.mod h1:y5Zk1BBys9G+gd6Jrk0W3cC1+ELVxBWuIGO+w/tUAp0= @@ -877,7 +874,6 @@ github.com/imdario/mergo v0.3.11/go.mod h1:jmQim1M+e3UYxmgPu/WyfjB3N3VflVyUjjjwH github.com/imdario/mergo v0.3.12/go.mod h1:jmQim1M+e3UYxmgPu/WyfjB3N3VflVyUjjjwH0dnCYA= github.com/imkira/go-interpol v1.1.0/go.mod h1:z0h2/2T3XF8kyEPpRgJ3kmNv+C43p+I/CoI+jC3w2iA= github.com/inconshreveable/mousetrap v1.0.0/go.mod h1:PxqpIevigyE2G7u3NXJIT2ANytuPF1OarO4DADm73n8= -github.com/inconshreveable/mousetrap v1.0.1/go.mod h1:vpF70FUmC8bwa3OWnCshd2FqLfsEA9PFc4w1p2J65bw= github.com/iris-contrib/blackfriday v2.0.0+incompatible/go.mod h1:UzZ2bDEoaSGPbkg6SAB4att1aAwTmVIx/5gCVqeyUdI= github.com/iris-contrib/go.uuid v2.0.0+incompatible/go.mod h1:iz2lgM/1UnEf1kP0L/+fafWORmlnuysV2EMP8MW+qe0= github.com/iris-contrib/jade v1.1.3/go.mod h1:H/geBymxJhShH5kecoiOCSssPX7QWYH7UaeZTSWddIk= @@ -1003,8 +999,8 @@ github.com/klauspost/compress v1.13.4/go.mod h1:8dP1Hq4DHOhN9w426knH3Rhby4rFm6D8 github.com/klauspost/compress v1.13.5/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47etQ6QUkpK6sk= github.com/klauspost/compress v1.13.6/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47etQ6QUkpK6sk= github.com/klauspost/compress v1.15.1/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47etQ6QUkpK6sk= -github.com/klauspost/compress v1.15.8 h1:JahtItbkWjf2jzm/T+qgMxkP9EMHsqEUA6vCMGmXvhA= -github.com/klauspost/compress v1.15.8/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHUDtV4Yw2GlzU= +github.com/klauspost/compress v1.16.0 h1:iULayQNOReoYUe+1qtKOqw9CwJv3aNQu8ivo7lw1HU4= +github.com/klauspost/compress v1.16.0/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE= github.com/klauspost/cpuid v1.2.0/go.mod h1:Pj4uuM528wm8OyEC2QMXAi2YiTZ96dNQPGgoMS4s3ek= github.com/klauspost/cpuid v1.2.1/go.mod h1:Pj4uuM528wm8OyEC2QMXAi2YiTZ96dNQPGgoMS4s3ek= github.com/klauspost/cpuid v1.2.3/go.mod h1:Pj4uuM528wm8OyEC2QMXAi2YiTZ96dNQPGgoMS4s3ek= @@ -1012,8 +1008,9 @@ github.com/klauspost/cpuid v1.3.1/go.mod h1:bYW4mA6ZgKPob1/Dlai2LviZJO7KGI3uoWLd github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.4/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.6/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.0.12 h1:p9dKCg8i4gmOxtv35DvrYoWqYzQrvEVdjQ762Y0OqZE= github.com/klauspost/cpuid/v2 v2.0.12/go.mod h1:g2LTdtYhdyuGPqyWyv7qRAmj1WBqxuObKfj5c0PQa7c= +github.com/klauspost/cpuid/v2 v2.2.3 h1:sxCkb+qR91z4vsqw4vGGZlDgPz3G7gjaLyK3V8y70BU= +github.com/klauspost/cpuid/v2 v2.2.3/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY= github.com/klauspost/pgzip v1.2.4/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/klauspost/pgzip v1.2.5/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/kljensen/snowball v0.6.0/go.mod h1:27N7E8fVU5H68RlUmnWwZCfxgt4POBJfENGMvNRhldw= @@ -1035,12 +1032,12 @@ github.com/kr/text v0.1.0/go.mod h1:4Jbv+DJW3UT/LiOwJeYQe1efqtUx/iVham/4vfdArNI= github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/ktrysmt/go-bitbucket v0.6.4/go.mod h1:9u0v3hsd2rqCHRIpbir1oP7F58uo5dq19sBYvuMoyQ4= -github.com/kyokomi/emoji/v2 v2.2.11 h1:Pf/ZWVTbnAVkHOLJLWjPxM/FmgyPe+d85cv/OLP5Yus= -github.com/kyokomi/emoji/v2 v2.2.11/go.mod h1:JUcn42DTdsXJo1SWanHh4HKDEyPaR5CqkmoirZZP9qE= +github.com/kyokomi/emoji/v2 v2.2.12 h1:sSVA5nH9ebR3Zji1o31wu3yOwD1zKXQA2z0zUyeit60= +github.com/kyokomi/emoji/v2 v2.2.12/go.mod h1:JUcn42DTdsXJo1SWanHh4HKDEyPaR5CqkmoirZZP9qE= github.com/labstack/echo/v4 v4.1.11/go.mod h1:i541M3Fj6f76NZtHSj7TXnyM8n2gaodfvfxNnFqi74g= github.com/labstack/echo/v4 v4.5.0/go.mod h1:czIriw4a0C1dFun+ObrXp7ok03xON0N1awStJ6ArI7Y= -github.com/labstack/echo/v4 v4.10.0 h1:5CiyngihEO4HXsz3vVsJn7f8xAlWwRr3aY6Ih280ZKA= -github.com/labstack/echo/v4 v4.10.0/go.mod h1:S/T/5fy/GigaXnHTkh0ZGe4LpkkQysvRjFMSUTkDRNQ= +github.com/labstack/echo/v4 v4.10.2 h1:n1jAhnq/elIFTHr1EYpiYtyKgx4RW9ccVgkqByZaN2M= +github.com/labstack/echo/v4 v4.10.2/go.mod h1:OEyqf2//K1DFdE57vw2DRgWY0M7s65IVQO2FzvI4J5k= github.com/labstack/gommon v0.3.0/go.mod h1:MULnywXg0yavhxWKc+lOruYdAhDwPK9wf0OL7NoOu+k= github.com/labstack/gommon v0.4.0 h1:y7cvthEAEbU0yHOf4axH8ZG2NH8knB9iNSoTO8dyIk8= github.com/labstack/gommon v0.4.0/go.mod h1:uW6kP17uPlLJsD3ijUYn3/M5bAxtlZhMI6m3MFxTMTM= @@ -1060,7 +1057,6 @@ github.com/lib/pq v1.10.2/go.mod h1:AlVN5x4E4T544tWzH6hKfbfQvm3HdbOxrmggDNAPY9o= github.com/lib/pq v1.10.4/go.mod h1:AlVN5x4E4T544tWzH6hKfbfQvm3HdbOxrmggDNAPY9o= github.com/lrstanley/girc v0.0.0-20221222153823-a92667a5c9b4 h1:eOJJOM8RTmDcK1F0SqCBX/Ic1vgDnAZfdll6oik0Ups= github.com/lrstanley/girc v0.0.0-20221222153823-a92667a5c9b4/go.mod h1:lgrnhcF8bg/Bd5HA5DOb4Z+uGqUqGnp4skr+J2GwVgI= -github.com/lufia/plan9stats v0.0.0-20211012122336-39d0f177ccd0/go.mod h1:zJYVVT2jmtg6P3p1VtQj7WsuWi/y4VnjVBn7F8KPB3I= github.com/lunixbochs/vtclean v1.0.0/go.mod h1:pHhQNgMf3btfWnGBVipUOjRYhoOsdGqdm/+2c2E2WMI= github.com/magiconair/properties v1.8.0/go.mod h1:PppfXfuXeibc/6YijjN8zIbojt8czPbwD3XqdrwzmxQ= github.com/magiconair/properties v1.8.1/go.mod h1:PppfXfuXeibc/6YijjN8zIbojt8czPbwD3XqdrwzmxQ= @@ -1087,8 +1083,8 @@ github.com/matterbridge/gozulipbot v0.0.0-20211023205727-a19d6c1f3b75 h1:GslZKF7 github.com/matterbridge/gozulipbot v0.0.0-20211023205727-a19d6c1f3b75/go.mod h1:yAjnZ34DuDyPHMPHHjOsTk/FefW4JJjoMMCGt/8uuQA= github.com/matterbridge/logrus-prefixed-formatter v0.5.3-0.20200523233437-d971309a77ba h1:XleOY4IjAEIcxAh+IFwT5JT5Ze3RHiYz6m+4ZfZ0rc0= github.com/matterbridge/logrus-prefixed-formatter v0.5.3-0.20200523233437-d971309a77ba/go.mod h1:iXGEotOvwI1R1SjLxRc+BF5rUORTMtE0iMZBT2lxqAU= -github.com/matterbridge/matterclient v0.0.0-20220624224459-272af20c7ddf h1:vaiRcLFKSD0fzlcLll53LU8HnpVv8XzP7C0mi8Tfvro= -github.com/matterbridge/matterclient v0.0.0-20220624224459-272af20c7ddf/go.mod h1:Zg8PH1P/1CNUxozQ8blnjAV9PA4Qn2qWf33cX5yNKGM= +github.com/matterbridge/matterclient v0.0.0-20221106190440-8bcf49695e0d h1:aI0ANEzy3dMv3vEAMQ80AItNie0fBR9ZxE2sAedORmM= +github.com/matterbridge/matterclient v0.0.0-20221106190440-8bcf49695e0d/go.mod h1:Zg8PH1P/1CNUxozQ8blnjAV9PA4Qn2qWf33cX5yNKGM= github.com/mattermost/go-i18n v1.11.0/go.mod h1:RyS7FDNQlzF1PsjbJWHRI35exqaKGSO9qD4iv8QjE34= github.com/mattermost/go-i18n v1.11.1-0.20211013152124-5c415071e404 h1:Khvh6waxG1cHc4Cz5ef9n3XVCxRWpAKUtqg9PJl5+y8= github.com/mattermost/go-i18n v1.11.1-0.20211013152124-5c415071e404/go.mod h1:RyS7FDNQlzF1PsjbJWHRI35exqaKGSO9qD4iv8QjE34= @@ -1129,8 +1125,9 @@ github.com/mattn/go-isatty v0.0.10/go.mod h1:qgIWMr58cqv1PHHyhnkY9lrL7etaEgOFcME github.com/mattn/go-isatty v0.0.12/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= github.com/mattn/go-isatty v0.0.13/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94= -github.com/mattn/go-isatty v0.0.16 h1:bq3VjFmv/sOjHtdEhmkEV4x1AJtvUvOJ2PFAZ5+peKQ= github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= +github.com/mattn/go-isatty v0.0.17 h1:BTarxUcIeDqL27Mc+vyvdWYSL28zpIhv3RoTdsLMPng= +github.com/mattn/go-isatty v0.0.17/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mattn/go-runewidth v0.0.2/go.mod h1:LwmH8dsx7+W8Uxz3IHJYH5QSwggIsqBzpuz5H//U1FU= github.com/mattn/go-runewidth v0.0.3/go.mod h1:LwmH8dsx7+W8Uxz3IHJYH5QSwggIsqBzpuz5H//U1FU= github.com/mattn/go-runewidth v0.0.7/go.mod h1:H031xJmbD/WCDINGzjvQ9THkh0rPKHF+m2gUSrubnMI= @@ -1365,7 +1362,6 @@ github.com/pkg/sftp v1.13.1/go.mod h1:3HaPG6Dq1ILlpPZRO0HVMrsydcdLt6HRDccSgb87qR github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndrE9hABlRI= -github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c/go.mod h1:OmDBASR4679mdNQnz2pUhc2G8CO2JrUAVFDRBDP/hJE= github.com/pquerna/cachecontrol v0.0.0-20171018203845-0dec1b30a021/go.mod h1:prYjPmNq4d1NPVmpShWobRqXY3q7Vp+80DqgxxUrUIA= github.com/prometheus/client_golang v0.0.0-20180209125602-c332b6f63c06/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= github.com/prometheus/client_golang v0.8.0/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= @@ -1416,8 +1412,9 @@ github.com/rcrowley/go-metrics v0.0.0-20181016184325-3113b8401b8a/go.mod h1:bCqn github.com/rcrowley/go-metrics v0.0.0-20190826022208-cac0b30c2563/go.mod h1:bCqnVzQkZxMG4s8nGwiZ5l3QUCyqpo9Y+/ZMZ9VjZe4= github.com/reflog/dateconstraints v0.2.1/go.mod h1:Ax8AxTBcJc3E/oVS2hd2j7RDM/5MDtuPwuR7lIHtPLo= github.com/remyoudompheng/bigfft v0.0.0-20190728182440-6a916e37a237/go.mod h1:qqbHyh8v60DhA7CoWK5oRCqLrMHRGoxYCSS9EjAz6Eo= -github.com/remyoudompheng/bigfft v0.0.0-20200410134404-eec4a21b6bb0 h1:OdAsTTz6OkFY5QxjkYwrChwuRruF69c169dPK26NUlk= github.com/remyoudompheng/bigfft v0.0.0-20200410134404-eec4a21b6bb0/go.mod h1:qqbHyh8v60DhA7CoWK5oRCqLrMHRGoxYCSS9EjAz6Eo= +github.com/remyoudompheng/bigfft v0.0.0-20230129092748-24d4a6f8daec h1:W09IVJc94icq4NjY3clb7Lk8O1qJ8BdBEF8z0ibU0rE= +github.com/remyoudompheng/bigfft v0.0.0-20230129092748-24d4a6f8daec/go.mod h1:qqbHyh8v60DhA7CoWK5oRCqLrMHRGoxYCSS9EjAz6Eo= github.com/richardlehane/mscfb v1.0.3/go.mod h1:YzVpcZg9czvAuhk9T+a3avCpcFPMUWm7gK3DypaEsUk= github.com/richardlehane/mscfb v1.0.4/go.mod h1:YzVpcZg9czvAuhk9T+a3avCpcFPMUWm7gK3DypaEsUk= github.com/richardlehane/msoleps v1.0.1/go.mod h1:BWev5JBpU9Ko2WAgmZEuiz4/u3ZYTKbjLycmwiWUfWg= @@ -1475,7 +1472,6 @@ github.com/shazow/rateio v0.0.0-20200113175441-4461efc8bdc4 h1:zwQ1HBo5FYwn1ksMd github.com/shazow/rateio v0.0.0-20200113175441-4461efc8bdc4/go.mod h1:vt2jWY/3Qw1bIzle5thrJWucsLuuX9iUNnp20CqCciI= github.com/shazow/ssh-chat v1.10.1 h1:ePS+ngEYqm+yUuXegDPutysqLV2WoI22XDOeRgI6CE0= github.com/shazow/ssh-chat v1.10.1/go.mod h1:0+7szsKylcre0vljkVnbuI6q7Odtc+QCDHxa+fFNV54= -github.com/shirou/gopsutil/v3 v3.22.10/go.mod h1:QNza6r4YQoydyCfo6rH0blGfKahgibh4dQmV5xdFkQk= github.com/shopspring/decimal v0.0.0-20180709203117-cd690d0c9e24/go.mod h1:M+9NzErvs504Cn4c5DxATwIqPbtswREoFCre64PpcG4= github.com/shopspring/decimal v0.0.0-20200227202807-02e2044944cc/go.mod h1:DKyhrW/HYNuLGql+MJL6WCR6knT2jwCFRcu2hWCYk4o= github.com/shopspring/decimal v1.2.0/go.mod h1:DKyhrW/HYNuLGql+MJL6WCR6knT2jwCFRcu2hWCYk4o= @@ -1554,7 +1550,6 @@ github.com/spf13/cobra v1.0.0/go.mod h1:/6GTrnGXV9HjY+aR4k0oJ5tcvakLuG6EuKReYlHN github.com/spf13/cobra v1.1.3/go.mod h1:pGADOWyqRD/YMrPZigI/zbliZ2wVD/23d+is3pSWzOo= github.com/spf13/cobra v1.2.1/go.mod h1:ExllRjgxM/piMAM+3tAZvg8fsklGAf3tPfi+i8t68Nk= github.com/spf13/cobra v1.4.0/go.mod h1:Wo4iy3BUC+X2Fybo0PDqwJIv3dNRiZLHQymsfxlB84g= -github.com/spf13/cobra v1.6.1/go.mod h1:IOw/AERYS7UzyrGinqmz6HLUo219MORXGxhbaJUqzrY= github.com/spf13/jwalterweatherman v1.0.0/go.mod h1:cQK4TGJAtQXfYWX+Ddv3mKDzgVb68N+wFjFa4jdeBTo= github.com/spf13/jwalterweatherman v1.1.0 h1:ue6voC5bR5F8YxI5S67j9i582FU4Qvo2bmqnqMYADFk= github.com/spf13/jwalterweatherman v1.1.0/go.mod h1:aNWZUN0dPAAO/Ljvb5BEdw96iTZ0EXowPYD95IqWIGo= @@ -1593,7 +1588,6 @@ github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5 github.com/stretchr/testify v1.6.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= -github.com/stretchr/testify v1.7.2/go.mod h1:R6va5+xMeoiuVRoj+gSkQ7d3FALtqAAGI1FQKckRals= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= github.com/stretchr/testify v1.8.1 h1:w7B6lhMri9wdJUVmEZPGGhZzrYTPvgJArz7wNPgYKsk= github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= @@ -1627,8 +1621,6 @@ github.com/tj/go-buffer v1.1.0/go.mod h1:iyiJpfFcR2B9sXu7KvjbT9fpM4mOelRSDTbntVj github.com/tj/go-elastic v0.0.0-20171221160941-36157cbbebc2/go.mod h1:WjeM0Oo1eNAjXGDx2yma7uG2XoyRZTq1uv3M/o7imD0= github.com/tj/go-kinesis v0.0.0-20171128231115-08b17f58cb1b/go.mod h1:/yhzCV0xPfx6jb1bBgRFjl5lytqVqZXEaeqWP8lTEao= github.com/tj/go-spin v1.1.0/go.mod h1:Mg1mzmePZm4dva8Qz60H2lHwmJ2loum4VIrLgVnKwh4= -github.com/tklauser/go-sysconf v0.3.10/go.mod h1:C8XykCvCb+Gn0oNCWPIlcb0RuglQTYaQ2hGm7jmxEFk= -github.com/tklauser/numcpus v0.4.0/go.mod h1:1+UI3pD8NW14VMwdgJNJ1ESk2UnwhAnz5hMwiKKqXCQ= github.com/tmc/grpc-websocket-proxy v0.0.0-20170815181823-89b8d40f7ca8/go.mod h1:ncp9v5uamzpCO7NfCPTXjqaC+bZgJeR0sMTm6dMHP7U= github.com/tmc/grpc-websocket-proxy v0.0.0-20190109142713-0ad062ec5ee5/go.mod h1:ncp9v5uamzpCO7NfCPTXjqaC+bZgJeR0sMTm6dMHP7U= github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM= @@ -1698,7 +1690,6 @@ github.com/xeipuuv/gojsonschema v0.0.0-20180618132009-1d523034197f/go.mod h1:5yf github.com/xeipuuv/gojsonschema v1.2.0/go.mod h1:anYRn/JVcOK2ZgGU+IjEV4nwlhoK5sQluxsYJ78Id3Y= github.com/xi2/xz v0.0.0-20171230120015-48954b6210f8/go.mod h1:HUYIGzjTL3rfEspMxjDjgmT5uz5wzYJKVo23qUhYTos= github.com/xiang90/probing v0.0.0-20190116061207-43a291ad63a2/go.mod h1:UETIi67q53MR2AWcXfiuqkDkRtnGDLqkBTpCHuJHxtU= -github.com/xlab/treeprint v1.1.0/go.mod h1:gj5Gd3gPdKtR1ikdDK6fnFLdmIS0X30kTTuNd/WEJu0= github.com/xordataexchange/crypt v0.0.3-0.20170626215501-b2862e3d0a77/go.mod h1:aYKd//L2LvnjZzWKhF00oedf4jCCReLcmhLdhm1A27Q= github.com/xtgo/uuid v0.0.0-20140804021211-a0b114877d4c h1:3lbZUMbMiGUW/LMkfsEABsc5zNT9+b1CvsJx47JzJ8g= github.com/xtgo/uuid v0.0.0-20140804021211-a0b114877d4c/go.mod h1:UrdRz5enIKZ63MEE3IF9l2/ebyx59GyGgPi+tICQdmM= @@ -1719,7 +1710,6 @@ github.com/yuin/goldmark v1.3.8/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1 github.com/yuin/goldmark v1.4.1/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k= github.com/yuin/goldmark v1.4.11/go.mod h1:rmuwmfZ0+bvzB24eSC//bk1R1Zp3hM0OXYv/G2LIilg= github.com/yuin/goldmark v1.4.13/go.mod h1:6yULJ656Px+3vBD8DxQVa3kxgyrAnzto9xy5taEt/CY= -github.com/yusufpapurcu/wmi v1.2.2/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0= github.com/yvasiyarov/go-metrics v0.0.0-20140926110328-57bccd1ccd43/go.mod h1:aX5oPXxHm3bOH+xeAttToC8pqch2ScQN/JoXYupl6xs= github.com/yvasiyarov/gorelic v0.0.0-20141212073537-a9bba5b9ab50/go.mod h1:NUSPSUX/bi6SeDMUh6brw0nXpxHnc96TguQh0+r/ssA= github.com/yvasiyarov/newrelic_platform_go v0.0.0-20140908184405-b21fdbd4370f/go.mod h1:GlGEuHIJweS1mbCqG+7vt2nvWLzLLnRHbXz5JKd/Qbg= @@ -1738,8 +1728,8 @@ go.etcd.io/etcd/client/pkg/v3 v3.5.0/go.mod h1:IJHfcCEKxYu1Os13ZdwCwIUTUVGYTSAM3 go.etcd.io/etcd/client/v2 v2.305.0/go.mod h1:h9puh54ZTgAKtEbut2oe9P4L/oqKCVB6xsXlzd7alYQ= go.mau.fi/libsignal v0.1.0 h1:vAKI/nJ5tMhdzke4cTK1fb0idJzz1JuEIpmjprueC+c= go.mau.fi/libsignal v0.1.0/go.mod h1:R8ovrTezxtUNzCQE5PH30StOQWWeBskBsWE55vMfY9I= -go.mau.fi/whatsmeow v0.0.0-20230128195103-dcbc8dd31a22 h1:za/zmM0hcfEKTRcLtr2zcUFE4VpUw8CndXNeV+v676c= -go.mau.fi/whatsmeow v0.0.0-20230128195103-dcbc8dd31a22/go.mod h1:TrdC8N6SnPFxWo5FiMnDIDFuVyfOLzy5dWDaUPNjcHY= +go.mau.fi/whatsmeow v0.0.0-20230306190159-5caded34a872 h1:jrIWy0l9kTxl7bdp3muFofZcyLyI1xxE7BXWeldVKr0= +go.mau.fi/whatsmeow v0.0.0-20230306190159-5caded34a872/go.mod h1:zoTtv1CupGEyTew7TOwnBmTbHB4pVad2OzjTf5CVwa0= go.mongodb.org/mongo-driver v1.1.0/go.mod h1:u7ryQJ+DOzQmeO7zB6MHyr8jkEQvC8vH7qLUO4lqsUM= go.mongodb.org/mongo-driver v1.7.0/go.mod h1:Q4oFMbo1+MSNqICAdYMlC/zSTrwCogR4R8NzkI+yfU8= go.mozilla.org/pkcs7 v0.0.0-20200128120323-432b2356ecb1/go.mod h1:SNgMg+EgDFwmvSmLRTNKC5fegJjB7v23qTQ0XLGUNHk= @@ -1826,8 +1816,8 @@ golang.org/x/crypto v0.0.0-20210817164053-32db794688a5/go.mod h1:GvvjBRRGRdwPK5y golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20211108221036-ceb1ce70b4fa/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= golang.org/x/crypto v0.0.0-20220331220935-ae2d96664a29/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4= -golang.org/x/crypto v0.4.0 h1:UVQgzMY87xqpKNgb+kDsll2Igd33HszWHFLmpaRMq/8= -golang.org/x/crypto v0.4.0/go.mod h1:3quD/ATkf6oY+rnes5c3ExXTbLc8mueNue5/DoinL80= +golang.org/x/crypto v0.6.0 h1:qfktjS5LUO+fFKeJXZ+ikTRijMmljikvG68fpMMruSc= +golang.org/x/crypto v0.6.0/go.mod h1:OFC/31mSvZgRz0V1QTNCzfAI1aIRzbiufJtkMIlEp58= golang.org/x/exp v0.0.0-20180321215751-8460e604b9de/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20180807140117-3d87b88a115f/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= @@ -1856,8 +1846,8 @@ golang.org/x/image v0.0.0-20201208152932-35266b937fa6/go.mod h1:FeLwcggjj3mMvU+o golang.org/x/image v0.0.0-20210216034530-4410531fe030/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= golang.org/x/image v0.0.0-20210622092929-e6eecd499c2c/go.mod h1:023OzeP/+EPmXeapQh35lcL3II3LrY8Ic+EFFKVhULM= golang.org/x/image v0.0.0-20220321031419-a8550c1d254a/go.mod h1:023OzeP/+EPmXeapQh35lcL3II3LrY8Ic+EFFKVhULM= -golang.org/x/image v0.3.0 h1:HTDXbdK9bjfSWkPzDJIw89W8CAtfFGduujWs33NLLsg= -golang.org/x/image v0.3.0/go.mod h1:fXd9211C/0VTlYuAcOhW8dY/RtEJqODXOWBDpmYBf+A= +golang.org/x/image v0.6.0 h1:bR8b5okrPI3g/gyZakLZHeWxAR8Dn5CyxXv1hLH5g/4= +golang.org/x/image v0.6.0/go.mod h1:MXLdDR43H7cDJq5GEGXEVeeNhPgi+YYEQ2pC1byI1x0= golang.org/x/lint v0.0.0-20180702182130-06c8688daad7/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE= golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE= golang.org/x/lint v0.0.0-20181217174547-8f45f776aaf1/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE= @@ -1885,8 +1875,9 @@ golang.org/x/mod v0.4.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.1/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.6.0-dev.0.20220106191415-9b9b3d81d5e3/go.mod h1:3p9vT2HGsQu2K1YbXdKPJLVgG5VJdoTa1poYQBtP1AY= -golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4 h1:6zppjxzCulZykYSLyVDYbneBfbaBIQPYMevg0bEwv2s= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= +golang.org/x/mod v0.8.0 h1:LUYupSeNrTNCGzR/hVBk2NHZO4hXcVaW1k4Qx7rjPx8= +golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/net v0.0.0-20180218175443-cbe0f9307d01/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180530234432-1e491301e022/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -1969,8 +1960,9 @@ golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su golang.org/x/net v0.0.0-20220225172249-27dd8689420f/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220403103023-749bd193bc2b/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= -golang.org/x/net v0.5.0 h1:GyT4nK/YDHSqa1c4753ouYCDajOYKTja9Xb/OHtgvSw= -golang.org/x/net v0.5.0/go.mod h1:DivGGAXEgPSlEBzxGzZI+ZLohi+xUj054jfeKui00ws= +golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs= +golang.org/x/net v0.8.0 h1:Zrh2ngAOFYneWTAIAPethzeaQLuHwhuBkuV6ZiRnUaQ= +golang.org/x/net v0.8.0/go.mod h1:QVkue5JL9kW//ek3r6jTKnTFis1tRmNAW2P1shuFdJc= golang.org/x/oauth2 v0.0.0-20180227000427-d7d64896b5ff/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20181017192945-9dcd33a902f4/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= @@ -1991,8 +1983,8 @@ golang.org/x/oauth2 v0.0.0-20210402161424-2e8d93401602/go.mod h1:KelEdhl1UZF7XfJ golang.org/x/oauth2 v0.0.0-20210514164344-f6687ab2804c/go.mod h1:KelEdhl1UZF7XfJ4dDtk6s++YSgaE7mD/BuKKDLBl4A= golang.org/x/oauth2 v0.0.0-20210628180205-a41e5a781914/go.mod h1:KelEdhl1UZF7XfJ4dDtk6s++YSgaE7mD/BuKKDLBl4A= golang.org/x/oauth2 v0.0.0-20220223155221-ee480838109b/go.mod h1:DAh4E804XQdzx2j+YRIaUnCqCV2RuMz24cGBJ5QYIrc= -golang.org/x/oauth2 v0.4.0 h1:NF0gk8LVPg1Ml7SSbGyySuoxdsXitj7TvgvuRxIMc/M= -golang.org/x/oauth2 v0.4.0/go.mod h1:RznEsdpjGAINPTOF0UH/t+xJ75L18YO3Ho6Pyn+uRec= +golang.org/x/oauth2 v0.6.0 h1:Lh8GPgSKBfWSwFvtuWOfeI3aAAnbXTSutYxJiOJFgIw= +golang.org/x/oauth2 v0.6.0/go.mod h1:ycmewcwgD4Rpr3eZJLSB4Kyyljb3qDh40vJ8STE5HKw= golang.org/x/perf v0.0.0-20180704124530-6e6d33e29852/go.mod h1:JLpeXjPJfIyPr5TlbXLkXWLhP8nz10XfvxElABhCtcw= golang.org/x/sync v0.0.0-20180314180146-1d60e4601c6f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -2007,6 +1999,8 @@ golang.org/x/sync v0.0.0-20201020160332-67f06af15bc9/go.mod h1:RxMgew5VJxzue5/jJ golang.org/x/sync v0.0.0-20201207232520-09787c993a3a/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.1.0 h1:wsuoTGHzEhffawBOhz5CYhcrV4IdKZbEyZjBMuTp12o= +golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sys v0.0.0-20180224232135-f6cff0780e54/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180823144017-11551d06cbcc/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180830151530-49385e6e1522/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -2099,7 +2093,6 @@ golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20201126233918-771906719818/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20201201145000-ef89a241ccb3/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20201202213521-69691e467435/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/sys v0.0.0-20201204225414-ed752295db88/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210104204734-6f8348627aad/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210112080510-489259a85091/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210119212857-b64e53b001e4/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= @@ -2134,20 +2127,22 @@ golang.org/x/sys v0.0.0-20211019181941-9d821ace8654/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20211103235746-7861aae1554b/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220114195835-da31bd327af9/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.0.0-20220128215802-99c3d69c2c27/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220403205710-6acee93ad0eb/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.4.0 h1:Zr2JFtRQNX3BCZ8YtxRE9hNJYC8J6I1MVbMg6owUp18= -golang.org/x/sys v0.4.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.6.0 h1:MVltZSvRTcU2ljQOhs94SXPftV6DCNnZViHeQps87pQ= +golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201117132131-f5c789dd3221/go.mod h1:Nr5EML6q2oocZ2LXRh80K7BxOlk5/8JxuGnuhpl+muw= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= -golang.org/x/term v0.4.0 h1:O7UWfv5+A2qiuulQk30kVinPoMtoIPeVaKLEgLpVkvg= -golang.org/x/term v0.4.0/go.mod h1:9P2UbLfCdcvo3p/nzKvsmas4TnlujnuoV9hGgYzW1lQ= +golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k= +golang.org/x/term v0.6.0 h1:clScbb1cHjoCkyRbWwBEUZ5H/tIFu5TAXIqaZD0Gcjw= +golang.org/x/term v0.6.0/go.mod h1:m6U89DPEgQRMq3DNkDClhWw02AUbt2daBVO4cn4Hv9U= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -2157,16 +2152,17 @@ golang.org/x/text v0.3.4/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.5/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= -golang.org/x/text v0.6.0 h1:3XmdazWV+ubf7QgHSTWeykHOci5oeekaGJBLkrkaw4k= -golang.org/x/text v0.6.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= +golang.org/x/text v0.8.0 h1:57P1ETyNKtuIjB4SRd15iJxuhj8Gc416Y78H3qgMh68= +golang.org/x/text v0.8.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= golang.org/x/time v0.0.0-20180412165947-fbb02b2291d2/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20200630173020-3af7569d3a1e/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20201208040808-7e3f01d25324/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= -golang.org/x/time v0.2.0 h1:52I/1L54xyEQAYdtcSuxtiT84KGYTBGXwayxmIpNJhE= -golang.org/x/time v0.2.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= +golang.org/x/time v0.3.0 h1:rg5rLMjNzMS1RkNLzCG38eapWhnYLFYXDXj2gOlr8j4= +golang.org/x/time v0.3.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/tools v0.0.0-20180221164845-07fd8470d635/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180525024113-a5b4c53f6e8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180828015842-6cd1fcedba52/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= @@ -2257,8 +2253,9 @@ golang.org/x/tools v0.1.4/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.6-0.20210726203631-07bc1bf47fb2/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= golang.org/x/tools v0.1.10/go.mod h1:Uh6Zz+xoGYZom868N8YTex3t7RhtHDBrE8Gzo9bV56E= -golang.org/x/tools v0.1.12 h1:VveCTK38A2rkS8ZqFY25HIDFscX5X9OoEhJd3quQmXU= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= +golang.org/x/tools v0.6.0 h1:BOw41kyTf3PuCW1pVQf8+Cyg8pMlkYB1oo9iJ6D/lKM= +golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= golang.org/x/xerrors v0.0.0-20190410155217-1f06c39b4373/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20190513163551-3ee3066db522/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= @@ -2437,8 +2434,8 @@ google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp0 google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= google.golang.org/protobuf v1.27.1/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= -google.golang.org/protobuf v1.28.1 h1:d0NfwRgPtno5B1Wa6L2DAG+KivqkdutMf1UhdNx175w= -google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= +google.golang.org/protobuf v1.29.0 h1:44S3JjaKmLEE4YIkjzexaP+NzZsudE3Zin5Njn/pYX0= +google.golang.org/protobuf v1.29.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= gopkg.in/airbrake/gobrake.v2 v2.0.9/go.mod h1:/h5ZAUhDkGaJfjzjKLSjv6zCL6O0LLBxU4K+aSYdM/U= gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw= gopkg.in/alexcesaro/quotedprintable.v3 v3.0.0-20150716171945-2caba252f4dc/go.mod h1:m7x9LTH6d71AHyAX77c9yqWCCa3UKHcVEj9y7hAtKDk= @@ -2653,8 +2650,8 @@ modernc.org/libc v1.11.98/go.mod h1:ynK5sbjsU77AP+nn61+k+wxUGRx9rOFcIqWYYMaDZ4c= modernc.org/libc v1.11.99/go.mod h1:wLLYgEiY2D17NbBOEp+mIJJJBGSiy7fLL4ZrGGZ+8jI= modernc.org/libc v1.11.101/go.mod h1:wLLYgEiY2D17NbBOEp+mIJJJBGSiy7fLL4ZrGGZ+8jI= modernc.org/libc v1.11.104/go.mod h1:2MH3DaF/gCU8i/UBiVE1VFRos4o523M7zipmwH8SIgQ= -modernc.org/libc v1.22.2 h1:4U7v51GyhlWqQmwCHj28Rdq2Yzwk55ovjFrdPjs8Hb0= -modernc.org/libc v1.22.2/go.mod h1:uvQavJ1pZ0hIoC/jfqNoMLURIMhKzINIWypNM17puug= +modernc.org/libc v1.22.3 h1:D/g6O5ftAfavceqlLOFwaZuA5KYafKwmr30A6iSqoyY= +modernc.org/libc v1.22.3/go.mod h1:MQrloYP209xa2zHome2a8HLiLm6k0UT8CoHpV74tOFw= modernc.org/lldb v1.0.0/go.mod h1:jcRvJGWfCGodDZz8BPwiKMJxGJngQ/5DrRapkQnLob8= modernc.org/mathutil v1.0.0/go.mod h1:wU0vUrJsVWBZ4P6e7xtFJEhFSNsfRLJ8H458uRjg03k= modernc.org/mathutil v1.1.1/go.mod h1:mZW8CKdRPY1v87qxC/wUdX5O1qDzXMP5TH3wjfpga6E= @@ -2665,8 +2662,8 @@ modernc.org/mathutil v1.5.0 h1:rV0Ko/6SfM+8G+yKiyI830l3Wuz1zRutdslNoQ0kfiQ= modernc.org/mathutil v1.5.0/go.mod h1:mZW8CKdRPY1v87qxC/wUdX5O1qDzXMP5TH3wjfpga6E= modernc.org/memory v1.0.4/go.mod h1:nV2OApxradM3/OVbs2/0OsP6nPfakXpi50C7dcoHXlc= modernc.org/memory v1.0.5/go.mod h1:B7OYswTRnfGg+4tDH1t1OeUNnsy2viGTdME4tzd+IjM= -modernc.org/memory v1.4.0 h1:crykUfNSnMAXaOJnnxcSzbUGMqkLWjklJKkBK2nwZwk= -modernc.org/memory v1.4.0/go.mod h1:PkUhL0Mugw21sHPeskwZW4D6VscE/GQJOnIpCnW6pSU= +modernc.org/memory v1.5.0 h1:N+/8c5rE6EqugZwHii4IFsaJ7MUhoWX07J5tC/iI5Ds= +modernc.org/memory v1.5.0/go.mod h1:PkUhL0Mugw21sHPeskwZW4D6VscE/GQJOnIpCnW6pSU= modernc.org/opt v0.1.1/go.mod h1:WdSiB5evDcignE70guQKxYUl14mgWtbClRi5wmkkTX0= modernc.org/opt v0.1.3 h1:3XOZf2yznlhC+ibLltsDGzABUGVx8J6pnFMS3E4dcq4= modernc.org/opt v0.1.3/go.mod h1:WdSiB5evDcignE70guQKxYUl14mgWtbClRi5wmkkTX0= @@ -2674,15 +2671,15 @@ modernc.org/ql v1.0.0/go.mod h1:xGVyrLIatPcO2C1JvI/Co8c0sr6y91HKFNy4pt9JXEY= modernc.org/sortutil v1.1.0/go.mod h1:ZyL98OQHJgH9IEfN71VsamvJgrtRX9Dj2gX+vH86L1k= modernc.org/sqlite v1.10.6/go.mod h1:Z9FEjUtZP4qFEg6/SiADg9XCER7aYy9a/j7Pg9P7CPs= modernc.org/sqlite v1.14.3/go.mod h1:xMpicS1i2MJ4C8+Ap0vYBqTwYfpFvdnPE6brbFOtV2Y= -modernc.org/sqlite v1.20.3 h1:SqGJMMxjj1PHusLxdYxeQSodg7Jxn9WWkaAQjKrntZs= -modernc.org/sqlite v1.20.3/go.mod h1:zKcGyrICaxNTMEHSr1HQ2GUraP0j+845GYw37+EyT6A= +modernc.org/sqlite v1.21.0 h1:4aP4MdUf15i3R3M2mx6Q90WHKz3nZLoz96zlB6tNdow= +modernc.org/sqlite v1.21.0/go.mod h1:XwQ0wZPIh1iKb5mkvCJ3szzbhk+tykC8ZWqTRTgYRwI= modernc.org/strutil v1.1.0/go.mod h1:lstksw84oURvj9y3tn8lGvRxyRC1S2+g5uuIzNfIOBs= modernc.org/strutil v1.1.1/go.mod h1:DE+MQQ/hjKBZS2zNInV5hhcipt5rLPWkmpbGeW5mmdw= modernc.org/strutil v1.1.3 h1:fNMm+oJklMGYfU9Ylcywl0CO5O6nTfaowNsh2wpPjzY= modernc.org/strutil v1.1.3/go.mod h1:MEHNA7PdEnEwLvspRMtWTNnp2nnyvMfkimT1NKNAGbw= modernc.org/tcl v1.5.2/go.mod h1:pmJYOLgpiys3oI4AeAafkcUfE+TKKilminxNyU/+Zlo= modernc.org/tcl v1.9.2/go.mod h1:aw7OnlIoiuJgu1gwbTZtrKnGpDqH9wyH++jZcxdqNsg= -modernc.org/tcl v1.15.0 h1:oY+JeD11qVVSgVvodMJsu7Edf8tr5E/7tuhF5cNYz34= +modernc.org/tcl v1.15.1 h1:mOQwiEK4p7HruMZcwKTZPw/aqtGM4aY00uzWhlKKYws= modernc.org/token v1.0.0/go.mod h1:UGzOrNV1mAFSEB63lOFHIpNRUVMvYTc6yu1SMY/XTDM= modernc.org/token v1.0.1 h1:A3qvTqOwexpfZZeyI0FeGPDlSWX5pjZu9hF4lU+EKWg= modernc.org/token v1.0.1/go.mod h1:UGzOrNV1mAFSEB63lOFHIpNRUVMvYTc6yu1SMY/XTDM= @@ -2692,7 +2689,6 @@ modernc.org/z v1.2.20/go.mod h1:zU9FiF4PbHdOTUxw+IF8j7ArBMRPsHgq10uVPt6xTzo= modernc.org/z v1.7.0 h1:xkDw/KepgEjeizO2sNco+hqYkU12taxQFqPEmgm1GWE= modernc.org/zappy v1.0.0/go.mod h1:hHe+oGahLVII/aTTyWK/b53VDHMAGCBYYeZ9sn83HC4= rsc.io/binaryregexp v0.2.0/go.mod h1:qTv7/COck+e2FymRvadv62gMdZztPaShugOCi3I+8D8= -rsc.io/goversion v1.2.0/go.mod h1:Eih9y/uIBS3ulggl7KNJ09xGSLcuNaLgmvvqa07sgfo= rsc.io/pdf v0.1.1/go.mod h1:n8OzWcQ6Sp37PL01nO98y4iUCRdTGarVfzxY20ICaU4= rsc.io/qr v0.2.0 h1:6vBLea5/NRMVTz8V66gipeLycZMl/+UlFmk8DvqQ6WY= rsc.io/qr v0.2.0/go.mod h1:IF+uZjkb9fqyeF/4tlBoynqmQxUoPfWEKh921coOuXs= diff --git a/matterbridge.toml.multi b/matterbridge.toml.multi new file mode 100644 index 00000000..35a9e347 --- /dev/null +++ b/matterbridge.toml.multi @@ -0,0 +1,61 @@ +#WARNING: as this file contains credentials, be sure to set correct file permissions + +[irc] + [irc.foo] + Server="irc.myfooserver.com:6667" + Nick="matterbot" + +# Can also connect to multiple different servers of the same protocol: +[irc] + [irc.bar] + Server="irc.mybarserver.com:6667" + Nick="matterbot" + +[telegram] + [telegram.mytelegram] + Token="123456789:FillInYourTokenHereThatIsImportant" + +[mattermost] + [mattermost.work] + #do not prefix it wit http:// or https:// + Server="yourmattermostserver.domain" + Team="yourteam" + Login="yourlogin" + Password="yourpass" + PrefixMessagesWithNick=true + +# Bridge 1: Copy all messages from all rooms to all rooms. +# This shows how you can have multiple rooms in a single bridge. +[[gateway]] +name="cats-are-cool" +enable=true + [[gateway.inout]] + account="irc.foo" + channel="#cats-are-cool" + [[gateway.inout]] + account="irc.bar" + channel="#cats-are-cool" + [[gateway.inout]] + account="telegram.mytelegram" + channel="-1234567890123" + [[gateway.inout]] + account="mattermost.work" + channel="cats-are-cool" + +# Bridge 2: Copy some messages from some rooms to some rooms. +# This shows how you can have multiple bridges. +[[gateway]] +name="dog-announcements" +enable=true + [[gateway.in]] + account="irc.foo" + channel="#dog-announcements" + [[gateway.in]] + account="irc.bar" + channel="#dog-announcements" + [[gateway.out]] + account="telegram.mytelegram" + channel="-9876543219876" + [[gateway.out]] + account="mattermost.work" + channel="dog-announcements" diff --git a/vendor/github.com/SevereCloud/vksdk/v2/.golangci.yml b/vendor/github.com/SevereCloud/vksdk/v2/.golangci.yml index 66712f60..8db41072 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/.golangci.yml +++ b/vendor/github.com/SevereCloud/vksdk/v2/.golangci.yml @@ -1,9 +1,11 @@ --- +run: + timeout: 5m + linters: disable-all: true enable: - bodyclose - - deadcode - errcheck - gochecknoglobals - goconst @@ -19,13 +21,11 @@ linters: - nakedret - prealloc - staticcheck - - structcheck - stylecheck - typecheck - unconvert - unparam - unused - - varcheck - whitespace - wsl - godot @@ -40,7 +40,6 @@ linters: - makezero - thelper - predeclared - - ifshort - revive - durationcheck - gomoddirectives @@ -57,9 +56,18 @@ linters: - grouper - decorder - containedctx - # - execinquery # FIXME: panic in 1.46.0 - nosprintfhostport + - usestdlibvars + - interfacebloat + - reassign + + - testableexamples + + - gocheckcompilerdirectives + - asasalint + +# - musttag # TODO: need update golangci-lint # - wrapcheck # TODO: v3 Fix # - testpackage # TODO: Fix testpackage # - noctx # TODO: Fix noctx @@ -90,11 +98,22 @@ linters: # - errchkjson # - maintidx # - nonamedreturns +# - nosnakecase +# - execinquery +# - logrlint + +# - dupword + +# - ginkgolinter # depricated # - maligned # - interfacer # - golint +# - ifshort +# - deadcode +# - structcheck +# - varcheck issues: exclude-rules: @@ -114,4 +133,8 @@ issues: - stylecheck text: "ST1003:.*(Ts|ts).*TS" + - linters: + - gosec + text: "G307:" + exclude-use-default: false diff --git a/vendor/github.com/SevereCloud/vksdk/v2/CONTRIBUTING.md b/vendor/github.com/SevereCloud/vksdk/v2/CONTRIBUTING.md index 76043620..589d1a3d 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/CONTRIBUTING.md +++ b/vendor/github.com/SevereCloud/vksdk/v2/CONTRIBUTING.md @@ -6,7 +6,7 @@ Требования: -- [Go 1.16+](https://golang.org/doc/install) +- [Go 1.18+](https://golang.org/doc/install) - [golangci-lint](https://github.com/golangci/golangci-lint) - [global .gitignore](https://help.github.com/en/articles/ignoring-files#create-a-global-gitignore) @@ -54,17 +54,17 @@ go test ./... ```json { - "go.testEnvVars": { - "SERVICE_TOKEN": "", - "WIDGET_TOKEN": "", - "MARUSIA_TOKEN": "", - "GROUP_TOKEN": "", - "CLIENT_SECRET": "", - "USER_TOKEN": "", - "CLIENT_ID": "123456", - "GROUP_ID": "123456", - "ACCOUNT_ID": "123456" - } + "go.testEnvVars": { + "SERVICE_TOKEN": "", + "WIDGET_TOKEN": "", + "MARUSIA_TOKEN": "", + "GROUP_TOKEN": "", + "CLIENT_SECRET": "", + "USER_TOKEN": "", + "CLIENT_ID": "123456", + "GROUP_ID": "123456", + "ACCOUNT_ID": "123456" + } } ``` @@ -88,7 +88,4 @@ git push origin ``` Затем откройте [pull request](https://github.com/SevereCloud/vksdk/pulls) -с веткой: - -- `master` если это багфикс -- `dev-v1.2.3` если это новая фича +с веткой master diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/ads.go b/vendor/github.com/SevereCloud/vksdk/v2/api/ads.go index 544143b3..92c083d8 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/ads.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/ads.go @@ -203,7 +203,6 @@ type AdsDeleteCampaignsResponse []ErrorType // AdsDeleteCampaigns archives advertising campaigns. // -// // Warning! Maximum allowed number of campaigns archived in one request is 100. // // https://vk.com/dev/ads.deleteCampaigns diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/api.go b/vendor/github.com/SevereCloud/vksdk/v2/api/api.go index c1fb3dea..47acd445 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/api.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/api.go @@ -152,7 +152,7 @@ type Params map[string]interface{} // cyrillic symbols will be transliterated automatically. // Numeric format from account.getInfo is supported as well. // -// p.Lang(object.LangRU) +// p.Lang(object.LangRU) // // See all language code in module object. func (p Params) Lang(v int) Params { @@ -248,7 +248,7 @@ func (vk *VK) DefaultHandler(method string, sliceParams ...Params) (Response, er rawBody := bytes.NewBufferString(query.Encode()) - req, err := http.NewRequestWithContext(ctx, "POST", u, rawBody) + req, err := http.NewRequestWithContext(ctx, http.MethodPost, u, rawBody) if err != nil { return response, err } diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/apps.go b/vendor/github.com/SevereCloud/vksdk/v2/api/apps.go index c0ecb38c..f6f1742b 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/apps.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/apps.go @@ -58,7 +58,7 @@ type AppsGetFriendsListResponse struct { // AppsGetFriendsList creates friends list for requests and invites in current app. // -// extended=0 +// extended=0 // // https://vk.com/dev/apps.getFriendsList func (vk *VK) AppsGetFriendsList(params Params) (response AppsGetFriendsListResponse, err error) { @@ -75,7 +75,7 @@ type AppsGetFriendsListExtendedResponse struct { // AppsGetFriendsListExtended creates friends list for requests and invites in current app. // -// extended=1 +// extended=1 // // https://vk.com/dev/apps.getFriendsList func (vk *VK) AppsGetFriendsListExtended(params Params) (response AppsGetFriendsListExtendedResponse, err error) { @@ -92,7 +92,7 @@ type AppsGetLeaderboardResponse struct { // AppsGetLeaderboard returns players rating in the game. // -// extended=0 +// extended=0 // // https://vk.com/dev/apps.getLeaderboard func (vk *VK) AppsGetLeaderboard(params Params) (response AppsGetLeaderboardResponse, err error) { @@ -113,7 +113,7 @@ type AppsGetLeaderboardExtendedResponse struct { // AppsGetLeaderboardExtended returns players rating in the game. // -// extended=1 +// extended=1 // // https://vk.com/dev/apps.getLeaderboard func (vk *VK) AppsGetLeaderboardExtended(params Params) (response AppsGetLeaderboardExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/auth.go b/vendor/github.com/SevereCloud/vksdk/v2/api/auth.go index 62a08c07..df5b76d7 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/auth.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/auth.go @@ -45,20 +45,20 @@ func (vk *VK) AuthGetProfileInfoBySilentToken(params Params) (response AuthGetPr // ExchangeSilentTokenSource call conditions exchangeSilentToken. // -// 0 Unknown -// 1 Silent authentication -// 2 Auth by login and password -// 3 Extended registration -// 4 Auth by exchange token -// 5 Auth by exchange token on reset password -// 6 Auth by exchange token on unblock -// 7 Auth by exchange token on reset session -// 8 Auth by exchange token on change password -// 9 Finish phone validation on authentication -// 10 Auth by code -// 11 Auth by external oauth -// 12 Reactivation -// 15 Auth by SDK temporary access-token +// 0 Unknown +// 1 Silent authentication +// 2 Auth by login and password +// 3 Extended registration +// 4 Auth by exchange token +// 5 Auth by exchange token on reset password +// 6 Auth by exchange token on unblock +// 7 Auth by exchange token on reset session +// 8 Auth by exchange token on change password +// 9 Finish phone validation on authentication +// 10 Auth by code +// 11 Auth by external oauth +// 12 Reactivation +// 15 Auth by SDK temporary access-token type ExchangeSilentTokenSource int // AuthExchangeSilentAuthTokenResponse struct. diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/board.go b/vendor/github.com/SevereCloud/vksdk/v2/api/board.go index 82ddd5c0..de5aeaae 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/board.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/board.go @@ -78,7 +78,7 @@ type BoardGetCommentsResponse struct { // BoardGetComments returns a list of comments on a topic on a community's discussion board. // -// extended=0 +// extended=0 // // https://vk.com/dev/board.getComments func (vk *VK) BoardGetComments(params Params) (response BoardGetCommentsResponse, err error) { @@ -99,7 +99,7 @@ type BoardGetCommentsExtendedResponse struct { // BoardGetCommentsExtended returns a list of comments on a topic on a community's discussion board. // -// extended=1 +// extended=1 // // https://vk.com/dev/board.getComments func (vk *VK) BoardGetCommentsExtended(params Params) (response BoardGetCommentsExtendedResponse, err error) { @@ -118,7 +118,7 @@ type BoardGetTopicsResponse struct { // BoardGetTopics returns a list of topics on a community's discussion board. // -// extended=0 +// extended=0 // // https://vk.com/dev/board.getTopics func (vk *VK) BoardGetTopics(params Params) (response BoardGetTopicsResponse, err error) { @@ -139,7 +139,7 @@ type BoardGetTopicsExtendedResponse struct { // BoardGetTopicsExtended returns a list of topics on a community's discussion board. // -// extended=1 +// extended=1 // // https://vk.com/dev/board.getTopics func (vk *VK) BoardGetTopicsExtended(params Params) (response BoardGetTopicsExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/calls.go b/vendor/github.com/SevereCloud/vksdk/v2/api/calls.go new file mode 100644 index 00000000..32a51cf2 --- /dev/null +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/calls.go @@ -0,0 +1,23 @@ +package api // import "github.com/SevereCloud/vksdk/v2/api" + +// CallsStartResponse struct. +type CallsStartResponse struct { + JoinLink string `json:"join_link"` + CallID string `json:"call_id"` +} + +// CallsStart method. +// +// https://vk.com/dev/calls.start +func (vk *VK) CallsStart(params Params) (response CallsStartResponse, err error) { + err = vk.RequestUnmarshal("calls.start", &response, params) + return +} + +// CallsForceFinish method. +// +// https://vk.com/dev/calls.forceFinish +func (vk *VK) CallsForceFinish(params Params) (response int, err error) { + err = vk.RequestUnmarshal("calls.forceFinish", &response, params) + return +} diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/execute.go b/vendor/github.com/SevereCloud/vksdk/v2/api/execute.go index 1ee04cee..1dd35e93 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/execute.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/execute.go @@ -13,8 +13,8 @@ import ( // The Args map variable allows you to retrieve the parameters passed during // the request and avoids code formatting. // -// return Args.code; // return parameter "code" -// return Args.v; // return parameter "v" +// return Args.code; // return parameter "code" +// return Args.v; // return parameter "v" // // https://vk.com/dev/execute func (vk *VK) ExecuteWithArgs(code string, params Params, obj interface{}) error { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/fave.go b/vendor/github.com/SevereCloud/vksdk/v2/api/fave.go index 5690aab8..b519f1b0 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/fave.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/fave.go @@ -79,7 +79,7 @@ type FaveGetResponse struct { // FaveGet method. // -// extended=0 +// extended=0 // // https://vk.com/dev/fave.get func (vk *VK) FaveGet(params Params) (response FaveGetResponse, err error) { @@ -97,7 +97,7 @@ type FaveGetExtendedResponse struct { // FaveGetExtended method. // -// extended=1 +// extended=1 // // https://vk.com/dev/fave.get func (vk *VK) FaveGetExtended(params Params) (response FaveGetExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/friends.go b/vendor/github.com/SevereCloud/vksdk/v2/api/friends.go index 07cfc7d7..4cbb8c7c 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/friends.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/friends.go @@ -169,7 +169,7 @@ func (vk *VK) FriendsGetMutual(params Params) (response FriendsGetMutualResponse // FriendsGetOnline returns a list of user IDs of a user's friends who are online. // -// online_mobile=0 +// online_mobile=0 // // https://vk.com/dev/friends.getOnline func (vk *VK) FriendsGetOnline(params Params) (response []int, err error) { @@ -186,7 +186,7 @@ type FriendsGetOnlineOnlineMobileResponse struct { // FriendsGetOnlineOnlineMobile returns a list of user IDs of a user's friends who are online. // -// online_mobile=1 +// online_mobile=1 // // https://vk.com/dev/friends.getOnline func (vk *VK) FriendsGetOnlineOnlineMobile(params Params) (response FriendsGetOnlineOnlineMobileResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/groups.go b/vendor/github.com/SevereCloud/vksdk/v2/api/groups.go index 72c4143f..868bee86 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/groups.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/groups.go @@ -157,7 +157,7 @@ type GroupsGetResponse struct { // GroupsGet returns a list of the communities to which a user belongs. // -// extended=0 +// extended=0 // // https://vk.com/dev/groups.get func (vk *VK) GroupsGet(params Params) (response GroupsGetResponse, err error) { @@ -174,7 +174,7 @@ type GroupsGetExtendedResponse struct { // GroupsGetExtended returns a list of the communities to which a user belongs. // -// extended=1 +// extended=1 // // https://vk.com/dev/groups.get func (vk *VK) GroupsGetExtended(params Params) (response GroupsGetExtendedResponse, err error) { @@ -273,6 +273,8 @@ type GroupsGetCatalogResponse struct { // GroupsGetCatalog returns communities list for a catalog category. // +// Deprecated: This method is deprecated and may be disabled soon, please avoid +// // https://vk.com/dev/groups.getCatalog func (vk *VK) GroupsGetCatalog(params Params) (response GroupsGetCatalogResponse, err error) { err = vk.RequestUnmarshal("groups.getCatalog", &response, params) @@ -287,7 +289,7 @@ type GroupsGetCatalogInfoResponse struct { // GroupsGetCatalogInfo returns categories list for communities catalog. // -// extended=0 +// extended=0 // // https://vk.com/dev/groups.getCatalogInfo func (vk *VK) GroupsGetCatalogInfo(params Params) (response GroupsGetCatalogInfoResponse, err error) { @@ -304,7 +306,7 @@ type GroupsGetCatalogInfoExtendedResponse struct { // GroupsGetCatalogInfoExtended returns categories list for communities catalog. // -// extended=1 +// extended=1 // // https://vk.com/dev/groups.getCatalogInfo func (vk *VK) GroupsGetCatalogInfoExtended(params Params) (response GroupsGetCatalogInfoExtendedResponse, err error) { @@ -421,7 +423,7 @@ type GroupsGetMembersFilterManagersResponse struct { // GroupsGetMembersFilterManagers returns a list of community members. // -// filter=managers +// filter=managers // // https://vk.com/dev/groups.getMembers func (vk *VK) GroupsGetMembersFilterManagers(params Params) ( @@ -522,7 +524,7 @@ func (vk *VK) GroupsInvite(params Params) (response int, err error) { // GroupsIsMember returns information specifying whether a user is a member of a community. // -// extended=0 +// extended=0 // // https://vk.com/dev/groups.isMember func (vk *VK) GroupsIsMember(params Params) (response int, err error) { @@ -542,7 +544,7 @@ type GroupsIsMemberExtendedResponse struct { // GroupsIsMemberExtended returns information specifying whether a user is a member of a community. // -// extended=1 +// extended=1 // // https://vk.com/dev/groups.isMember func (vk *VK) GroupsIsMemberExtended(params Params) (response GroupsIsMemberExtendedResponse, err error) { @@ -556,8 +558,8 @@ type GroupsIsMemberUserIDsExtendedResponse []object.GroupsMemberStatusFull // GroupsIsMemberUserIDsExtended returns information specifying whether a user is a member of a community. // -// extended=1 -// need user_ids +// extended=1 +// need user_ids // // https://vk.com/dev/groups.isMember func (vk *VK) GroupsIsMemberUserIDsExtended(params Params) (response GroupsIsMemberUserIDsExtendedResponse, err error) { @@ -571,8 +573,8 @@ type GroupsIsMemberUserIDsResponse []object.GroupsMemberStatus // GroupsIsMemberUserIDs returns information specifying whether a user is a member of a community. // -// extended=0 -// need user_ids +// extended=0 +// need user_ids // // https://vk.com/dev/groups.isMember func (vk *VK) GroupsIsMemberUserIDs(params Params) (response GroupsIsMemberUserIDsResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/likes.go b/vendor/github.com/SevereCloud/vksdk/v2/api/likes.go index 047c2935..fc89c08b 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/likes.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/likes.go @@ -38,7 +38,7 @@ type LikesGetListResponse struct { // LikesGetList likes.getList returns a list of IDs of users who added the specified object to their Likes list. // -// extended=0 +// extended=0 // // https://vk.com/dev/likes.getList func (vk *VK) LikesGetList(params Params) (response LikesGetListResponse, err error) { @@ -55,7 +55,7 @@ type LikesGetListExtendedResponse struct { // LikesGetListExtended likes.getList returns a list of IDs of users who added the specified object to their Likes list. // -// extended=1 +// extended=1 // // https://vk.com/dev/likes.getList func (vk *VK) LikesGetListExtended(params Params) (response LikesGetListExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/market.go b/vendor/github.com/SevereCloud/vksdk/v2/api/market.go index 6b823818..e11f5a9f 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/market.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/market.go @@ -181,7 +181,7 @@ type MarketGetCommentsResponse struct { // MarketGetComments returns comments list for an item. // -// extended=0 +// extended=0 // // https://vk.com/dev/market.getComments func (vk *VK) MarketGetComments(params Params) (response MarketGetCommentsResponse, err error) { @@ -199,7 +199,7 @@ type MarketGetCommentsExtendedResponse struct { // MarketGetCommentsExtended returns comments list for an item. // -// extended=1 +// extended=1 // // https://vk.com/dev/market.getComments func (vk *VK) MarketGetCommentsExtended(params Params) (response MarketGetCommentsExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/messages.go b/vendor/github.com/SevereCloud/vksdk/v2/api/messages.go index 7a0bebc4..0b15a6a5 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/messages.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/messages.go @@ -118,6 +118,8 @@ func (vk *VK) MessagesEditChat(params Params) (response int, err error) { // MessagesForceCallFinish method. // +// Deprecated: Use CallsForceFinish +// // https://vk.com/dev/messages.forceCallFinish func (vk *VK) MessagesForceCallFinish(params Params) (response int, err error) { err = vk.RequestUnmarshal("messages.forceCallFinish", &response, params) @@ -150,7 +152,7 @@ type MessagesGetByIDResponse struct { // MessagesGetByID returns messages by their IDs. // -// extended=0 +// extended=0 // // https://vk.com/dev/messages.getById func (vk *VK) MessagesGetByID(params Params) (response MessagesGetByIDResponse, err error) { @@ -168,7 +170,7 @@ type MessagesGetByIDExtendedResponse struct { // MessagesGetByIDExtended returns messages by their IDs. // -// extended=1 +// extended=1 // // https://vk.com/dev/messages.getById func (vk *VK) MessagesGetByIDExtended(params Params) (response MessagesGetByIDExtendedResponse, err error) { @@ -268,7 +270,7 @@ type MessagesGetConversationsByIDResponse struct { // MessagesGetConversationsByID returns conversations by their IDs. // -// extended=0 +// extended=0 // // https://vk.com/dev/messages.getConversationsById func (vk *VK) MessagesGetConversationsByID(params Params) (response MessagesGetConversationsByIDResponse, err error) { @@ -286,7 +288,7 @@ type MessagesGetConversationsByIDExtendedResponse struct { // MessagesGetConversationsByIDExtended returns conversations by their IDs. // -// extended=1 +// extended=1 // // https://vk.com/dev/messages.getConversationsById func (vk *VK) MessagesGetConversationsByIDExtended(params Params) ( @@ -583,7 +585,7 @@ type MessagesSendUserIDsResponse []struct { // MessagesSendPeerIDs sends a message. // -// need peer_ids; +// need peer_ids; // // https://vk.com/dev/messages.send func (vk *VK) MessagesSendPeerIDs(params Params) (response MessagesSendUserIDsResponse, err error) { @@ -593,7 +595,7 @@ func (vk *VK) MessagesSendPeerIDs(params Params) (response MessagesSendUserIDsRe // MessagesSendUserIDs sends a message. // -// need user_ids or peer_ids; +// need user_ids or peer_ids; // // https://vk.com/dev/messages.send // @@ -649,6 +651,8 @@ type MessagesStartCallResponse struct { // MessagesStartCall method. // +// Deprecated: Use CallsStart +// // https://vk.com/dev/messages.startCall func (vk *VK) MessagesStartCall(params Params) (response MessagesStartCallResponse, err error) { err = vk.RequestUnmarshal("messages.startCall", &response, params) diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/newsfeed.go b/vendor/github.com/SevereCloud/vksdk/v2/api/newsfeed.go index 36ce1453..52f19cf3 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/newsfeed.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/newsfeed.go @@ -53,7 +53,7 @@ type NewsfeedGetBannedResponse struct { // NewsfeedGetBanned returns a list of users and communities banned from the current user's newsfeed. // -// extended=0 +// extended=0 // // https://vk.com/dev/newsfeed.getBanned func (vk *VK) NewsfeedGetBanned(params Params) (response NewsfeedGetBannedResponse, err error) { @@ -69,7 +69,7 @@ type NewsfeedGetBannedExtendedResponse struct { // NewsfeedGetBannedExtended returns a list of users and communities banned from the current user's newsfeed. // -// extended=1 +// extended=1 // // https://vk.com/dev/newsfeed.getBanned func (vk *VK) NewsfeedGetBannedExtended(params Params) (response NewsfeedGetBannedExtendedResponse, err error) { @@ -183,7 +183,7 @@ type NewsfeedSearchResponse struct { // NewsfeedSearch returns search results by statuses. // -// extended=0 +// extended=0 // // https://vk.com/dev/newsfeed.search func (vk *VK) NewsfeedSearch(params Params) (response NewsfeedSearchResponse, err error) { @@ -204,7 +204,7 @@ type NewsfeedSearchExtendedResponse struct { // NewsfeedSearchExtended returns search results by statuses. // -// extended=1 +// extended=1 // // https://vk.com/dev/newsfeed.search func (vk *VK) NewsfeedSearchExtended(params Params) (response NewsfeedSearchExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/photos.go b/vendor/github.com/SevereCloud/vksdk/v2/api/photos.go index d52cbeed..3754814c 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/photos.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/photos.go @@ -95,7 +95,7 @@ type PhotosGetResponse struct { // PhotosGet returns a list of a user's or community's photos. // -// extended=0 +// extended=0 // // https://vk.com/dev/photos.get func (vk *VK) PhotosGet(params Params) (response PhotosGetResponse, err error) { @@ -112,7 +112,7 @@ type PhotosGetExtendedResponse struct { // PhotosGetExtended returns a list of a user's or community's photos. // -// extended=1 +// extended=1 // // https://vk.com/dev/photos.get func (vk *VK) PhotosGetExtended(params Params) (response PhotosGetExtendedResponse, err error) { @@ -152,7 +152,7 @@ type PhotosGetAllResponse struct { // PhotosGetAll returns a list of photos belonging to a user or community, in reverse chronological order. // -// extended=0 +// extended=0 // // https://vk.com/dev/photos.getAll func (vk *VK) PhotosGetAll(params Params) (response PhotosGetAllResponse, err error) { @@ -170,7 +170,7 @@ type PhotosGetAllExtendedResponse struct { // PhotosGetAllExtended returns a list of photos belonging to a user or community, in reverse chronological order. // -// extended=1 +// extended=1 // // https://vk.com/dev/photos.getAll func (vk *VK) PhotosGetAllExtended(params Params) (response PhotosGetAllExtendedResponse, err error) { @@ -199,7 +199,7 @@ type PhotosGetByIDResponse []object.PhotosPhoto // PhotosGetByID returns information about photos by their IDs. // -// extended=0 +// extended=0 // // https://vk.com/dev/photos.getById func (vk *VK) PhotosGetByID(params Params) (response PhotosGetByIDResponse, err error) { @@ -213,7 +213,7 @@ type PhotosGetByIDExtendedResponse []object.PhotosPhotoFull // PhotosGetByIDExtended returns information about photos by their IDs. // -// extended=1 +// extended=1 // // https://vk.com/dev/photos.getById func (vk *VK) PhotosGetByIDExtended(params Params) (response PhotosGetByIDExtendedResponse, err error) { @@ -244,7 +244,7 @@ type PhotosGetCommentsResponse struct { // PhotosGetComments returns a list of comments on a photo. // -// extended=0 +// extended=0 // // https://vk.com/dev/photos.getComments func (vk *VK) PhotosGetComments(params Params) (response PhotosGetCommentsResponse, err error) { @@ -264,7 +264,7 @@ type PhotosGetCommentsExtendedResponse struct { // PhotosGetCommentsExtended returns a list of comments on a photo. // -// extended=1 +// extended=1 // // https://vk.com/dev/photos.getComments func (vk *VK) PhotosGetCommentsExtended(params Params) (response PhotosGetCommentsExtendedResponse, err error) { @@ -395,7 +395,7 @@ type PhotosGetUserPhotosResponse struct { // PhotosGetUserPhotos returns a list of photos in which a user is tagged. // -// extended=0 +// extended=0 // // https://vk.com/dev/photos.getUserPhotos func (vk *VK) PhotosGetUserPhotos(params Params) (response PhotosGetUserPhotosResponse, err error) { @@ -412,7 +412,7 @@ type PhotosGetUserPhotosExtendedResponse struct { // PhotosGetUserPhotosExtended returns a list of photos in which a user is tagged. // -// extended=1 +// extended=1 // // https://vk.com/dev/photos.getUserPhotos func (vk *VK) PhotosGetUserPhotosExtended(params Params) (response PhotosGetUserPhotosExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/podcasts.go b/vendor/github.com/SevereCloud/vksdk/v2/api/podcasts.go index 8534d0fc..51ffb8cb 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/podcasts.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/podcasts.go @@ -11,7 +11,7 @@ type PodcastsGetCatalogResponse struct { // PodcastsGetCatalog method. // -// extended=0 +// extended=0 // // https://vk.com/dev/podcasts.getCatalog func (vk *VK) PodcastsGetCatalog(params Params) (response PodcastsGetCatalogResponse, err error) { @@ -28,7 +28,7 @@ type PodcastsGetCatalogExtendedResponse struct { // PodcastsGetCatalogExtended method. // -// extended=1 +// extended=1 // // https://vk.com/dev/podcasts.getCatalog func (vk *VK) PodcastsGetCatalogExtended(params Params) (response PodcastsGetCatalogExtendedResponse, err error) { @@ -70,7 +70,7 @@ type PodcastsGetFeedResponse struct { // PodcastsGetFeed method. // -// extended=0 +// extended=0 // // https://vk.com/dev/podcasts.getFeed func (vk *VK) PodcastsGetFeed(params Params) (response PodcastsGetFeedResponse, err error) { @@ -88,7 +88,7 @@ type PodcastsGetFeedExtendedResponse struct { // PodcastsGetFeedExtended method. // -// extended=1 +// extended=1 // // https://vk.com/dev/podcasts.getFeed func (vk *VK) PodcastsGetFeedExtended(params Params) (response PodcastsGetFeedExtendedResponse, err error) { @@ -116,7 +116,7 @@ type PodcastsGetStartPageResponse struct { // PodcastsGetStartPage method. // -// extended=0 +// extended=0 // // https://vk.com/dev/podcasts.getStartPage func (vk *VK) PodcastsGetStartPage(params Params) (response PodcastsGetStartPageResponse, err error) { @@ -145,7 +145,7 @@ type PodcastsGetStartPageExtendedResponse struct { // PodcastsGetStartPageExtended method. // -// extended=1 +// extended=1 // // https://vk.com/dev/podcasts.getStartPage func (vk *VK) PodcastsGetStartPageExtended(params Params) (response PodcastsGetStartPageExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/stories.go b/vendor/github.com/SevereCloud/vksdk/v2/api/stories.go index b68424b8..d3893029 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/stories.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/stories.go @@ -30,7 +30,7 @@ type StoriesGetResponse struct { // StoriesGet returns stories available for current user. // -// extended=0 +// extended=0 // // https://vk.com/dev/stories.get func (vk *VK) StoriesGet(params Params) (response StoriesGetResponse, err error) { @@ -50,7 +50,7 @@ type StoriesGetExtendedResponse struct { // StoriesGetExtended returns stories available for current user. // -// extended=1 +// extended=1 // // https://vk.com/dev/stories.get func (vk *VK) StoriesGetExtended(params Params) (response StoriesGetExtendedResponse, err error) { @@ -67,7 +67,7 @@ type StoriesGetBannedResponse struct { // StoriesGetBanned returns list of sources hidden from current user's feed. // -// extended=0 +// extended=0 // // https://vk.com/dev/stories.getBanned func (vk *VK) StoriesGetBanned(params Params) (response StoriesGetBannedResponse, err error) { @@ -85,7 +85,7 @@ type StoriesGetBannedExtendedResponse struct { // StoriesGetBannedExtended returns list of sources hidden from current user's feed. // -// extended=1 +// extended=1 // // https://vk.com/dev/stories.getBanned func (vk *VK) StoriesGetBannedExtended(params Params) (response StoriesGetBannedExtendedResponse, err error) { @@ -102,7 +102,7 @@ type StoriesGetByIDResponse struct { // StoriesGetByID returns story by its ID. // -// extended=0 +// extended=0 // // https://vk.com/dev/stories.getById func (vk *VK) StoriesGetByID(params Params) (response StoriesGetByIDResponse, err error) { @@ -120,7 +120,7 @@ type StoriesGetByIDExtendedResponse struct { // StoriesGetByIDExtended returns story by its ID. // -// extended=1 +// extended=1 // // https://vk.com/dev/stories.getById func (vk *VK) StoriesGetByIDExtended(params Params) (response StoriesGetByIDExtendedResponse, err error) { @@ -152,7 +152,7 @@ type StoriesGetRepliesResponse struct { // StoriesGetReplies returns replies to the story. // -// extended=0 +// extended=0 // // https://vk.com/dev/stories.getReplies func (vk *VK) StoriesGetReplies(params Params) (response StoriesGetRepliesResponse, err error) { @@ -170,7 +170,7 @@ type StoriesGetRepliesExtendedResponse struct { // StoriesGetRepliesExtended returns replies to the story. // -// extended=1 +// extended=1 // // https://vk.com/dev/stories.getReplies func (vk *VK) StoriesGetRepliesExtended(params Params) (response StoriesGetRepliesExtendedResponse, err error) { @@ -213,7 +213,7 @@ type StoriesGetViewersResponse struct { // StoriesGetViewers returns a list of story viewers. // -// extended=0 +// extended=0 // // https://vk.com/dev/stories.getViewers func (vk *VK) StoriesGetViewers(params Params) (response StoriesGetViewersResponse, err error) { @@ -261,7 +261,7 @@ type StoriesSearchResponse struct { // StoriesSearch returns search results for stories. // -// extended=0 +// extended=0 // // https://vk.com/dev/stories.search func (vk *VK) StoriesSearch(params Params) (response StoriesSearchResponse, err error) { @@ -279,7 +279,7 @@ type StoriesSearchExtendedResponse struct { // StoriesSearchExtended returns search results for stories. // -// extended=1 +// extended=1 // // https://vk.com/dev/stories.search func (vk *VK) StoriesSearchExtended(params Params) (response StoriesSearchExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/upload.go b/vendor/github.com/SevereCloud/vksdk/v2/api/upload.go index 59f65460..70362ebe 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/upload.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/upload.go @@ -4,7 +4,6 @@ import ( "bytes" "encoding/json" "io" - "io/ioutil" "mime/multipart" "github.com/SevereCloud/vksdk/v2/object" @@ -34,7 +33,7 @@ func (vk *VK) UploadFile(url string, file io.Reader, fieldname, filename string) } defer resp.Body.Close() - bodyContent, err = ioutil.ReadAll(resp.Body) + bodyContent, err = io.ReadAll(resp.Body) return } @@ -214,7 +213,7 @@ func (vk *VK) uploadOwnerPhoto(params Params, squareCrop string, file io.Reader) } defer resp.Body.Close() - bodyContent, err := ioutil.ReadAll(resp.Body) + bodyContent, err := io.ReadAll(resp.Body) if err != nil { return } diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/users.go b/vendor/github.com/SevereCloud/vksdk/v2/api/users.go index 2251d562..fdd25ead 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/users.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/users.go @@ -24,7 +24,7 @@ type UsersGetFollowersResponse struct { // UsersGetFollowers returns a list of IDs of followers of the user in // question, sorted by date added, most recent first. // -// fields=""; +// fields=""; // // https://vk.com/dev/users.getFollowers func (vk *VK) UsersGetFollowers(params Params) (response UsersGetFollowersResponse, err error) { @@ -70,7 +70,7 @@ type UsersGetSubscriptionsResponse struct { // UsersGetSubscriptions returns a list of IDs of users and public pages followed by the user. // -// extended=0 +// extended=0 // // https://vk.com/dev/users.getSubscriptions // diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/utils.go b/vendor/github.com/SevereCloud/vksdk/v2/api/utils.go index 965c26f2..97030e94 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/utils.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/utils.go @@ -43,7 +43,7 @@ type UtilsGetLinkStatsResponse object.UtilsLinkStats // UtilsGetLinkStats returns stats data for shortened link. // -// extended=0 +// extended=0 // // https://vk.com/dev/utils.getLinkStats func (vk *VK) UtilsGetLinkStats(params Params) (response UtilsGetLinkStatsResponse, err error) { @@ -57,7 +57,7 @@ type UtilsGetLinkStatsExtendedResponse object.UtilsLinkStatsExtended // UtilsGetLinkStatsExtended returns stats data for shortened link. // -// extended=1 +// extended=1 // // https://vk.com/dev/utils.getLinkStats func (vk *VK) UtilsGetLinkStatsExtended(params Params) (response UtilsGetLinkStatsExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/video.go b/vendor/github.com/SevereCloud/vksdk/v2/api/video.go index 01b7f83e..de9eee5a 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/video.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/video.go @@ -97,7 +97,7 @@ type VideoGetResponse struct { // VideoGet returns detailed information about videos. // -// extended=0 +// extended=0 // // https://vk.com/dev/video.get func (vk *VK) VideoGet(params Params) (response VideoGetResponse, err error) { @@ -115,7 +115,7 @@ type VideoGetExtendedResponse struct { // VideoGetExtended returns detailed information about videos. // -// extended=1 +// extended=1 // // https://vk.com/dev/video.get func (vk *VK) VideoGetExtended(params Params) (response VideoGetExtendedResponse, err error) { @@ -143,7 +143,7 @@ type VideoGetAlbumsResponse struct { // VideoGetAlbums returns a list of video albums owned by a user or community. // -// extended=0 +// extended=0 // // https://vk.com/dev/video.getAlbums func (vk *VK) VideoGetAlbums(params Params) (response VideoGetAlbumsResponse, err error) { @@ -160,7 +160,7 @@ type VideoGetAlbumsExtendedResponse struct { // VideoGetAlbumsExtended returns a list of video albums owned by a user or community. // -// extended=1 +// extended=1 // // https://vk.com/dev/video.getAlbums func (vk *VK) VideoGetAlbumsExtended(params Params) (response VideoGetAlbumsExtendedResponse, err error) { @@ -174,7 +174,7 @@ type VideoGetAlbumsByVideoResponse []int // VideoGetAlbumsByVideo returns a list of albums in which the video is located. // -// extended=0 +// extended=0 // // https://vk.com/dev/video.getAlbumsByVideo func (vk *VK) VideoGetAlbumsByVideo(params Params) (response VideoGetAlbumsByVideoResponse, err error) { @@ -191,7 +191,7 @@ type VideoGetAlbumsByVideoExtendedResponse struct { // VideoGetAlbumsByVideoExtended returns a list of albums in which the video is located. // -// extended=1 +// extended=1 // // https://vk.com/dev/video.getAlbumsByVideo func (vk *VK) VideoGetAlbumsByVideoExtended(params Params) (response VideoGetAlbumsByVideoExtendedResponse, err error) { @@ -208,7 +208,7 @@ type VideoGetCommentsResponse struct { // VideoGetComments returns a list of comments on a video. // -// extended=0 +// extended=0 // // https://vk.com/dev/video.getComments func (vk *VK) VideoGetComments(params Params) (response VideoGetCommentsResponse, err error) { @@ -226,7 +226,7 @@ type VideoGetCommentsExtendedResponse struct { // VideoGetCommentsExtended returns a list of comments on a video. // -// extended=1 +// extended=1 // // https://vk.com/dev/video.getComments func (vk *VK) VideoGetCommentsExtended(params Params) (response VideoGetCommentsExtendedResponse, err error) { @@ -321,7 +321,7 @@ type VideoSearchResponse struct { // VideoSearch returns a list of videos under the set search criterion. // -// extended=0 +// extended=0 // // https://vk.com/dev/video.search func (vk *VK) VideoSearch(params Params) (response VideoSearchResponse, err error) { @@ -339,7 +339,7 @@ type VideoSearchExtendedResponse struct { // VideoSearchExtended returns a list of videos under the set search criterion. // -// extended=1 +// extended=1 // // https://vk.com/dev/video.search func (vk *VK) VideoSearchExtended(params Params) (response VideoSearchExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/api/wall.go b/vendor/github.com/SevereCloud/vksdk/v2/api/wall.go index e951a749..81dab18a 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/api/wall.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/api/wall.go @@ -87,7 +87,7 @@ type WallGetResponse struct { // WallGet returns a list of posts on a user wall or community wall. // -// extended=0 +// extended=0 // // https://vk.com/dev/wall.get func (vk *VK) WallGet(params Params) (response WallGetResponse, err error) { @@ -105,7 +105,7 @@ type WallGetExtendedResponse struct { // WallGetExtended returns a list of posts on a user wall or community wall. // -// extended=1 +// extended=1 // // https://vk.com/dev/wall.get func (vk *VK) WallGetExtended(params Params) (response WallGetExtendedResponse, err error) { @@ -119,7 +119,7 @@ type WallGetByIDResponse []object.WallWallpost // WallGetByID returns a list of posts from user or community walls by their IDs. // -// extended=0 +// extended=0 // // https://vk.com/dev/wall.getById func (vk *VK) WallGetByID(params Params) (response WallGetByIDResponse, err error) { @@ -136,7 +136,7 @@ type WallGetByIDExtendedResponse struct { // WallGetByIDExtended returns a list of posts from user or community walls by their IDs. // -// extended=1 +// extended=1 // // https://vk.com/dev/wall.getById func (vk *VK) WallGetByIDExtended(params Params) (response WallGetByIDExtendedResponse, err error) { @@ -156,7 +156,7 @@ type WallGetCommentResponse struct { // WallGetComment allows to obtain wall comment info. // -// extended=0 +// extended=0 // // https://vk.com/dev/wall.getComment func (vk *VK) WallGetComment(params Params) (response WallGetCommentResponse, err error) { @@ -179,7 +179,7 @@ type WallGetCommentExtendedResponse struct { // WallGetCommentExtended allows to obtain wall comment info. // -// extended=1 +// extended=1 // // https://vk.com/dev/wall.getComment func (vk *VK) WallGetCommentExtended(params Params) (response WallGetCommentExtendedResponse, err error) { @@ -200,7 +200,7 @@ type WallGetCommentsResponse struct { // WallGetComments returns a list of comments on a post on a user wall or community wall. // -// extended=0 +// extended=0 // // https://vk.com/dev/wall.getComments func (vk *VK) WallGetComments(params Params) (response WallGetCommentsResponse, err error) { @@ -222,7 +222,7 @@ type WallGetCommentsExtendedResponse struct { // WallGetCommentsExtended returns a list of comments on a post on a user wall or community wall. // -// extended=1 +// extended=1 // // https://vk.com/dev/wall.getComments func (vk *VK) WallGetCommentsExtended(params Params) (response WallGetCommentsExtendedResponse, err error) { @@ -347,7 +347,7 @@ type WallSearchResponse struct { // WallSearch allows to search posts on user or community walls. // -// extended=0 +// extended=0 // // https://vk.com/dev/wall.search func (vk *VK) WallSearch(params Params) (response WallSearchResponse, err error) { @@ -365,7 +365,7 @@ type WallSearchExtendedResponse struct { // WallSearchExtended allows to search posts on user or community walls. // -// extended=1 +// extended=1 // // https://vk.com/dev/wall.search func (vk *VK) WallSearchExtended(params Params) (response WallSearchExtendedResponse, err error) { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/doc.go b/vendor/github.com/SevereCloud/vksdk/v2/doc.go index a61bad7d..9862a5fe 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/doc.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/doc.go @@ -7,6 +7,6 @@ package vksdk // Module constants. const ( - Version = "2.15.0" + Version = "2.16.0" API = "5.131" ) diff --git a/vendor/github.com/SevereCloud/vksdk/v2/events/events.go b/vendor/github.com/SevereCloud/vksdk/v2/events/events.go index 2bda613a..babc23f6 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/events/events.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/events/events.go @@ -156,13 +156,15 @@ func NewFuncList() *FuncList { } // Handler group event handler. -func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint:gocyclo +func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { //nolint:gocyclo ctx = context.WithValue(ctx, internal.GroupIDKey, e.GroupID) ctx = context.WithValue(ctx, internal.EventIDKey, e.EventID) ctx = context.WithValue(ctx, internal.EventVersionKey, e.V) if sliceFunc, ok := fl.special[e.Type]; ok { for _, f := range sliceFunc { + f := f + if fl.goroutine { go func() { f(ctx, e) }() } else { @@ -179,6 +181,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -192,6 +196,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageReply { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -205,6 +211,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -218,6 +226,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageAllow { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -231,6 +241,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageDeny { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -244,6 +256,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageTypingState { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -257,6 +271,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageEvent { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -270,6 +286,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.photoNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -283,6 +301,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.photoCommentNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -296,6 +316,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.photoCommentEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -309,6 +331,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.photoCommentRestore { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -322,6 +346,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.photoCommentDelete { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -335,6 +361,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.audioNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -348,6 +376,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.videoNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -361,6 +391,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.videoCommentNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -374,6 +406,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.videoCommentEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -387,6 +421,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.videoCommentRestore { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -400,6 +436,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.videoCommentDelete { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -413,6 +451,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.wallPostNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -426,6 +466,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.wallRepost { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -439,6 +481,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.wallReplyNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -452,6 +496,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.wallReplyEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -465,6 +511,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.wallReplyRestore { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -478,6 +526,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.wallReplyDelete { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -491,6 +541,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.boardPostNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -504,6 +556,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.boardPostEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -517,6 +571,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.boardPostRestore { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -530,6 +586,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.boardPostDelete { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -543,6 +601,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.marketCommentNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -556,6 +616,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.marketCommentEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -569,6 +631,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.marketCommentRestore { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -582,6 +646,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.marketCommentDelete { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -595,6 +661,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.marketOrderNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -608,6 +676,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.marketOrderEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -621,6 +691,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.groupLeave { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -634,6 +706,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.groupJoin { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -647,6 +721,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.userBlock { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -660,6 +736,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.userUnblock { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -673,6 +751,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.pollVoteNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -686,6 +766,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.groupOfficersEdit { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -699,6 +781,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.groupChangeSettings { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -712,6 +796,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.groupChangePhoto { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -725,6 +811,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.vkpayTransaction { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -738,6 +826,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.leadFormsNew { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -751,6 +841,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.appPayload { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -764,6 +856,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.messageRead { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -777,6 +871,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.likeAdd { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -790,6 +886,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.likeRemove { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -803,6 +901,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutSubscriptionCreate { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -816,6 +916,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutSubscriptionProlonged { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -829,6 +931,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutSubscriptionExpired { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -842,6 +946,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutSubscriptionCancelled { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -855,6 +961,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutSubscriptionPriceChanged { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -868,6 +976,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutMoneyWithdraw { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { @@ -881,6 +991,8 @@ func (fl FuncList) Handler(ctx context.Context, e GroupEvent) error { // nolint: } for _, f := range fl.donutMoneyWithdrawError { + f := f + if fl.goroutine { go func() { f(ctx, obj) }() } else { diff --git a/vendor/github.com/SevereCloud/vksdk/v2/object/stats.go b/vendor/github.com/SevereCloud/vksdk/v2/object/stats.go index b8fe5001..46b891ba 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/object/stats.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/object/stats.go @@ -66,12 +66,24 @@ type StatsViews struct { // StatsWallpostStat struct. type StatsWallpostStat struct { + PostID int `json:"post_id"` Hide int `json:"hide"` // Hidings number JoinGroup int `json:"join_group"` // People have joined the group Links int `json:"links"` // Link click-through ReachSubscribers int `json:"reach_subscribers"` // Subscribers reach ReachTotal int `json:"reach_total"` // Total reach + ReachViral int `json:"reach_viral"` // Viral reach + ReachAds int `json:"reach_ads"` // Advertising reach Report int `json:"report"` // Reports number ToGroup int `json:"to_group"` // Click-through to community Unsubscribe int `json:"unsubscribe"` // Unsubscribed members + AdViews int `json:"ad_views"` + AdSubscribers int `json:"ad_subscribers"` + AdHide int `json:"ad_hide"` + AdUnsubscribe int `json:"ad_unsubscribe"` + AdLinks int `json:"ad_links"` + AdToGroup int `json:"ad_to_group"` + AdJoinGroup int `json:"ad_join_group"` + AdCoverage int `json:"ad_coverage"` + AdReport int `json:"ad_report"` } diff --git a/vendor/github.com/SevereCloud/vksdk/v2/object/stories.go b/vendor/github.com/SevereCloud/vksdk/v2/object/stories.go index 5f87745a..5de9494c 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/object/stories.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/object/stories.go @@ -239,7 +239,7 @@ func (cs StoriesClickableStickers) ToJSON() string { } // StoriesClickableSticker struct. -type StoriesClickableSticker struct { // nolint: maligned +type StoriesClickableSticker struct { //nolint: maligned ID int `json:"id"` Type string `json:"type"` ClickableArea []StoriesClickablePoint `json:"clickable_area"` diff --git a/vendor/github.com/SevereCloud/vksdk/v2/object/users.go b/vendor/github.com/SevereCloud/vksdk/v2/object/users.go index 91ef92be..9027229c 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/object/users.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/object/users.go @@ -125,6 +125,7 @@ type UsersUser struct { MobilePhone string `json:"mobile_phone"` HomePhone string `json:"home_phone"` FoundWith int `json:"found_with"` // TODO: check it + ImageStatus ImageStatusInfo `json:"image_status"` OnlineInfo UsersOnlineInfo `json:"online_info"` Mutual FriendsRequestsMutual `json:"mutual"` TrackCode string `json:"track_code"` @@ -138,6 +139,13 @@ func (user UsersUser) ToMention() string { return fmt.Sprintf("[id%d|%s %s]", user.ID, user.FirstName, user.LastName) } +// ImageStatusInfo struct. +type ImageStatusInfo struct { + ID int `json:"id"` + Name string `json:"name"` + Images []BaseImage `json:"images"` +} + // UsersOnlineInfo struct. type UsersOnlineInfo struct { AppID int `json:"app_id"` diff --git a/vendor/github.com/SevereCloud/vksdk/v2/object/wall.go b/vendor/github.com/SevereCloud/vksdk/v2/object/wall.go index 1a195b39..99443659 100644 --- a/vendor/github.com/SevereCloud/vksdk/v2/object/wall.go +++ b/vendor/github.com/SevereCloud/vksdk/v2/object/wall.go @@ -161,6 +161,7 @@ type WallWallpost struct { Edited int `json:"edited"` // Date of editing in Unixtime Copyright WallPostCopyright `json:"copyright"` PostID int `json:"post_id"` + PostponedID int `json:"postponed_id"` // ID from scheduled posts ParentsStack []int `json:"parents_stack"` Donut WallWallpostDonut `json:"donut"` ShortTextRate float64 `json:"short_text_rate"` diff --git a/vendor/github.com/google/gops/agent/agent.go b/vendor/github.com/google/gops/agent/agent.go index de6d90f9..b7978069 100644 --- a/vendor/github.com/google/gops/agent/agent.go +++ b/vendor/github.com/google/gops/agent/agent.go @@ -12,7 +12,6 @@ import ( "encoding/binary" "fmt" "io" - "io/ioutil" "net" "os" gosignal "os/signal" @@ -115,7 +114,7 @@ func Listen(opts Options) error { } port := listener.Addr().(*net.TCPAddr).Port portfile = filepath.Join(gopsdir, strconv.Itoa(os.Getpid())) - err = ioutil.WriteFile(portfile, []byte(strconv.Itoa(port)), os.ModePerm) + err = os.WriteFile(portfile, []byte(strconv.Itoa(port)), os.ModePerm) if err != nil { return err } diff --git a/vendor/github.com/google/gops/internal/internal.go b/vendor/github.com/google/gops/internal/internal.go index 7fc162a6..7e3492aa 100644 --- a/vendor/github.com/google/gops/internal/internal.go +++ b/vendor/github.com/google/gops/internal/internal.go @@ -6,11 +6,9 @@ package internal import ( "errors" - "io/ioutil" "os" "os/user" "path/filepath" - "runtime" "strconv" "strings" ) @@ -26,14 +24,6 @@ func ConfigDir() (string, error) { return filepath.Join(userConfigDir, "gops"), nil } - if runtime.GOOS == "windows" { - return filepath.Join(os.Getenv("APPDATA"), "gops"), nil - } - - if xdgConfigDir := os.Getenv("XDG_CONFIG_HOME"); xdgConfigDir != "" { - return filepath.Join(xdgConfigDir, "gops"), nil - } - homeDir := guessUnixHomeDir() if homeDir == "" { return "", errors.New("unable to get current user home directory: os/user lookup failed; $HOME is empty") @@ -62,7 +52,7 @@ func GetPort(pid int) (string, error) { if err != nil { return "", err } - b, err := ioutil.ReadFile(portfile) + b, err := os.ReadFile(portfile) if err != nil { return "", err } diff --git a/vendor/github.com/klauspost/compress/.goreleaser.yml b/vendor/github.com/klauspost/compress/.goreleaser.yml index 0af08e65..7a008a4d 100644 --- a/vendor/github.com/klauspost/compress/.goreleaser.yml +++ b/vendor/github.com/klauspost/compress/.goreleaser.yml @@ -3,7 +3,7 @@ before: hooks: - ./gen.sh - - go install mvdan.cc/garble@latest + - go install mvdan.cc/garble@v0.9.3 builds: - diff --git a/vendor/github.com/klauspost/compress/README.md b/vendor/github.com/klauspost/compress/README.md index c7cf1a20..958666ed 100644 --- a/vendor/github.com/klauspost/compress/README.md +++ b/vendor/github.com/klauspost/compress/README.md @@ -9,7 +9,6 @@ This package provides various compression algorithms. * [huff0](https://github.com/klauspost/compress/tree/master/huff0) and [FSE](https://github.com/klauspost/compress/tree/master/fse) implementations for raw entropy encoding. * [gzhttp](https://github.com/klauspost/compress/tree/master/gzhttp) Provides client and server wrappers for handling gzipped requests efficiently. * [pgzip](https://github.com/klauspost/pgzip) is a separate package that provides a very fast parallel gzip implementation. -* [fuzz package](https://github.com/klauspost/compress-fuzz) for fuzz testing all compressors/decompressors here. [![Go Reference](https://pkg.go.dev/badge/klauspost/compress.svg)](https://pkg.go.dev/github.com/klauspost/compress?tab=subdirectories) [![Go](https://github.com/klauspost/compress/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/compress/actions/workflows/go.yml) @@ -17,6 +16,62 @@ This package provides various compression algorithms. # changelog +* Jan 21st, 2023 (v1.15.15) + * deflate: Improve level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/739 + * zstd: Add delta encoding support by @greatroar in https://github.com/klauspost/compress/pull/728 + * zstd: Various speed improvements by @greatroar https://github.com/klauspost/compress/pull/741 https://github.com/klauspost/compress/pull/734 https://github.com/klauspost/compress/pull/736 https://github.com/klauspost/compress/pull/744 https://github.com/klauspost/compress/pull/743 https://github.com/klauspost/compress/pull/745 + * gzhttp: Add SuffixETag() and DropETag() options to prevent ETag collisions on compressed responses by @willbicks in https://github.com/klauspost/compress/pull/740 + +* Jan 3rd, 2023 (v1.15.14) + + * flate: Improve speed in big stateless blocks https://github.com/klauspost/compress/pull/718 + * zstd: Minor speed tweaks by @greatroar in https://github.com/klauspost/compress/pull/716 https://github.com/klauspost/compress/pull/720 + * export NoGzipResponseWriter for custom ResponseWriter wrappers by @harshavardhana in https://github.com/klauspost/compress/pull/722 + * s2: Add example for indexing and existing stream https://github.com/klauspost/compress/pull/723 + +* Dec 11, 2022 (v1.15.13) + * zstd: Add [MaxEncodedSize](https://pkg.go.dev/github.com/klauspost/compress@v1.15.13/zstd#Encoder.MaxEncodedSize) to encoder https://github.com/klauspost/compress/pull/691 + * zstd: Various tweaks and improvements https://github.com/klauspost/compress/pull/693 https://github.com/klauspost/compress/pull/695 https://github.com/klauspost/compress/pull/696 https://github.com/klauspost/compress/pull/701 https://github.com/klauspost/compress/pull/702 https://github.com/klauspost/compress/pull/703 https://github.com/klauspost/compress/pull/704 https://github.com/klauspost/compress/pull/705 https://github.com/klauspost/compress/pull/706 https://github.com/klauspost/compress/pull/707 https://github.com/klauspost/compress/pull/708 + +* Oct 26, 2022 (v1.15.12) + + * zstd: Tweak decoder allocs. https://github.com/klauspost/compress/pull/680 + * gzhttp: Always delete `HeaderNoCompression` https://github.com/klauspost/compress/pull/683 + +* Sept 26, 2022 (v1.15.11) + + * flate: Improve level 1-3 compression https://github.com/klauspost/compress/pull/678 + * zstd: Improve "best" compression by @nightwolfz in https://github.com/klauspost/compress/pull/677 + * zstd: Fix+reduce decompression allocations https://github.com/klauspost/compress/pull/668 + * zstd: Fix non-effective noescape tag https://github.com/klauspost/compress/pull/667 + +* Sept 16, 2022 (v1.15.10) + + * zstd: Add [WithDecodeAllCapLimit](https://pkg.go.dev/github.com/klauspost/compress@v1.15.10/zstd#WithDecodeAllCapLimit) https://github.com/klauspost/compress/pull/649 + * Add Go 1.19 - deprecate Go 1.16 https://github.com/klauspost/compress/pull/651 + * flate: Improve level 5+6 compression https://github.com/klauspost/compress/pull/656 + * zstd: Improve "better" compresssion https://github.com/klauspost/compress/pull/657 + * s2: Improve "best" compression https://github.com/klauspost/compress/pull/658 + * s2: Improve "better" compression. https://github.com/klauspost/compress/pull/635 + * s2: Slightly faster non-assembly decompression https://github.com/klauspost/compress/pull/646 + * Use arrays for constant size copies https://github.com/klauspost/compress/pull/659 + +* July 21, 2022 (v1.15.9) + + * zstd: Fix decoder crash on amd64 (no BMI) on invalid input https://github.com/klauspost/compress/pull/645 + * zstd: Disable decoder extended memory copies (amd64) due to possible crashes https://github.com/klauspost/compress/pull/644 + * zstd: Allow single segments up to "max decoded size" by @klauspost in https://github.com/klauspost/compress/pull/643 + +* July 13, 2022 (v1.15.8) + + * gzip: fix stack exhaustion bug in Reader.Read https://github.com/klauspost/compress/pull/641 + * s2: Add Index header trim/restore https://github.com/klauspost/compress/pull/638 + * zstd: Optimize seqdeq amd64 asm by @greatroar in https://github.com/klauspost/compress/pull/636 + * zstd: Improve decoder memcopy https://github.com/klauspost/compress/pull/637 + * huff0: Pass a single bitReader pointer to asm by @greatroar in https://github.com/klauspost/compress/pull/634 + * zstd: Branchless getBits for amd64 w/o BMI2 by @greatroar in https://github.com/klauspost/compress/pull/640 + * gzhttp: Remove header before writing https://github.com/klauspost/compress/pull/639 + * June 29, 2022 (v1.15.7) * s2: Fix absolute forward seeks https://github.com/klauspost/compress/pull/633 @@ -81,15 +136,15 @@ This package provides various compression algorithms. * gzhttp: Add zstd to transport by @klauspost in [#400](https://github.com/klauspost/compress/pull/400) * gzhttp: Make content-type optional by @klauspost in [#510](https://github.com/klauspost/compress/pull/510) -
- See Details Both compression and decompression now supports "synchronous" stream operations. This means that whenever "concurrency" is set to 1, they will operate without spawning goroutines. Stream decompression is now faster on asynchronous, since the goroutine allocation much more effectively splits the workload. On typical streams this will typically use 2 cores fully for decompression. When a stream has finished decoding no goroutines will be left over, so decoders can now safely be pooled and still be garbage collected. While the release has been extensively tested, it is recommended to testing when upgrading. -
+
+ See changes to v1.14.x + * Feb 22, 2022 (v1.14.4) * flate: Fix rare huffman only (-2) corruption. [#503](https://github.com/klauspost/compress/pull/503) * zip: Update deprecated CreateHeaderRaw to correctly call CreateRaw by @saracen in [#502](https://github.com/klauspost/compress/pull/502) @@ -115,6 +170,7 @@ While the release has been extensively tested, it is recommended to testing when * zstd: Performance improvement in [#420]( https://github.com/klauspost/compress/pull/420) [#456](https://github.com/klauspost/compress/pull/456) [#437](https://github.com/klauspost/compress/pull/437) [#467](https://github.com/klauspost/compress/pull/467) [#468](https://github.com/klauspost/compress/pull/468) * zstd: add arm64 xxhash assembly in [#464](https://github.com/klauspost/compress/pull/464) * Add garbled for binaries for s2 in [#445](https://github.com/klauspost/compress/pull/445) +
See changes to v1.13.x diff --git a/vendor/github.com/klauspost/compress/fse/compress.go b/vendor/github.com/klauspost/compress/fse/compress.go index 6f341914..dac97e58 100644 --- a/vendor/github.com/klauspost/compress/fse/compress.go +++ b/vendor/github.com/klauspost/compress/fse/compress.go @@ -146,54 +146,51 @@ func (s *Scratch) compress(src []byte) error { c1.encodeZero(tt[src[ip-2]]) ip -= 2 } + src = src[:ip] // Main compression loop. switch { case !s.zeroBits && s.actualTableLog <= 8: // We can encode 4 symbols without requiring a flush. // We do not need to check if any output is 0 bits. - for ip >= 4 { + for ; len(src) >= 4; src = src[:len(src)-4] { s.bw.flush32() - v3, v2, v1, v0 := src[ip-4], src[ip-3], src[ip-2], src[ip-1] + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] c2.encode(tt[v0]) c1.encode(tt[v1]) c2.encode(tt[v2]) c1.encode(tt[v3]) - ip -= 4 } case !s.zeroBits: // We do not need to check if any output is 0 bits. - for ip >= 4 { + for ; len(src) >= 4; src = src[:len(src)-4] { s.bw.flush32() - v3, v2, v1, v0 := src[ip-4], src[ip-3], src[ip-2], src[ip-1] + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] c2.encode(tt[v0]) c1.encode(tt[v1]) s.bw.flush32() c2.encode(tt[v2]) c1.encode(tt[v3]) - ip -= 4 } case s.actualTableLog <= 8: // We can encode 4 symbols without requiring a flush - for ip >= 4 { + for ; len(src) >= 4; src = src[:len(src)-4] { s.bw.flush32() - v3, v2, v1, v0 := src[ip-4], src[ip-3], src[ip-2], src[ip-1] + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] c2.encodeZero(tt[v0]) c1.encodeZero(tt[v1]) c2.encodeZero(tt[v2]) c1.encodeZero(tt[v3]) - ip -= 4 } default: - for ip >= 4 { + for ; len(src) >= 4; src = src[:len(src)-4] { s.bw.flush32() - v3, v2, v1, v0 := src[ip-4], src[ip-3], src[ip-2], src[ip-1] + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] c2.encodeZero(tt[v0]) c1.encodeZero(tt[v1]) s.bw.flush32() c2.encodeZero(tt[v2]) c1.encodeZero(tt[v3]) - ip -= 4 } } @@ -459,15 +456,17 @@ func (s *Scratch) countSimple(in []byte) (max int) { for _, v := range in { s.count[v]++ } - m := uint32(0) + m, symlen := uint32(0), s.symbolLen for i, v := range s.count[:] { + if v == 0 { + continue + } if v > m { m = v } - if v > 0 { - s.symbolLen = uint16(i) + 1 - } + symlen = uint16(i) + 1 } + s.symbolLen = symlen return int(m) } diff --git a/vendor/github.com/klauspost/compress/huff0/bitreader.go b/vendor/github.com/klauspost/compress/huff0/bitreader.go index 504a7be9..e36d9742 100644 --- a/vendor/github.com/klauspost/compress/huff0/bitreader.go +++ b/vendor/github.com/klauspost/compress/huff0/bitreader.go @@ -67,7 +67,6 @@ func (b *bitReaderBytes) fillFast() { // 2 bounds checks. v := b.in[b.off-4 : b.off] - v = v[:4] low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) b.value |= uint64(low) << (b.bitsRead - 32) b.bitsRead -= 32 @@ -88,8 +87,7 @@ func (b *bitReaderBytes) fill() { return } if b.off > 4 { - v := b.in[b.off-4:] - v = v[:4] + v := b.in[b.off-4 : b.off] low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) b.value |= uint64(low) << (b.bitsRead - 32) b.bitsRead -= 32 @@ -179,7 +177,6 @@ func (b *bitReaderShifted) fillFast() { // 2 bounds checks. v := b.in[b.off-4 : b.off] - v = v[:4] low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) b.value |= uint64(low) << ((b.bitsRead - 32) & 63) b.bitsRead -= 32 @@ -200,8 +197,7 @@ func (b *bitReaderShifted) fill() { return } if b.off > 4 { - v := b.in[b.off-4:] - v = v[:4] + v := b.in[b.off-4 : b.off] low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) b.value |= uint64(low) << ((b.bitsRead - 32) & 63) b.bitsRead -= 32 diff --git a/vendor/github.com/klauspost/compress/huff0/compress.go b/vendor/github.com/klauspost/compress/huff0/compress.go index 4d14542f..cdc94856 100644 --- a/vendor/github.com/klauspost/compress/huff0/compress.go +++ b/vendor/github.com/klauspost/compress/huff0/compress.go @@ -365,29 +365,29 @@ func (s *Scratch) countSimple(in []byte) (max int, reuse bool) { m := uint32(0) if len(s.prevTable) > 0 { for i, v := range s.count[:] { + if v == 0 { + continue + } if v > m { m = v } - if v > 0 { - s.symbolLen = uint16(i) + 1 - if i >= len(s.prevTable) { - reuse = false - } else { - if s.prevTable[i].nBits == 0 { - reuse = false - } - } + s.symbolLen = uint16(i) + 1 + if i >= len(s.prevTable) { + reuse = false + } else if s.prevTable[i].nBits == 0 { + reuse = false } } return int(m), reuse } for i, v := range s.count[:] { + if v == 0 { + continue + } if v > m { m = v } - if v > 0 { - s.symbolLen = uint16(i) + 1 - } + s.symbolLen = uint16(i) + 1 } return int(m), false } @@ -484,34 +484,35 @@ func (s *Scratch) buildCTable() error { // Different from reference implementation. huffNode0 := s.nodes[0 : huffNodesLen+1] - for huffNode[nonNullRank].count == 0 { + for huffNode[nonNullRank].count() == 0 { nonNullRank-- } lowS := int16(nonNullRank) nodeRoot := nodeNb + lowS - 1 lowN := nodeNb - huffNode[nodeNb].count = huffNode[lowS].count + huffNode[lowS-1].count - huffNode[lowS].parent, huffNode[lowS-1].parent = uint16(nodeNb), uint16(nodeNb) + huffNode[nodeNb].setCount(huffNode[lowS].count() + huffNode[lowS-1].count()) + huffNode[lowS].setParent(nodeNb) + huffNode[lowS-1].setParent(nodeNb) nodeNb++ lowS -= 2 for n := nodeNb; n <= nodeRoot; n++ { - huffNode[n].count = 1 << 30 + huffNode[n].setCount(1 << 30) } // fake entry, strong barrier - huffNode0[0].count = 1 << 31 + huffNode0[0].setCount(1 << 31) // create parents for nodeNb <= nodeRoot { var n1, n2 int16 - if huffNode0[lowS+1].count < huffNode0[lowN+1].count { + if huffNode0[lowS+1].count() < huffNode0[lowN+1].count() { n1 = lowS lowS-- } else { n1 = lowN lowN++ } - if huffNode0[lowS+1].count < huffNode0[lowN+1].count { + if huffNode0[lowS+1].count() < huffNode0[lowN+1].count() { n2 = lowS lowS-- } else { @@ -519,18 +520,19 @@ func (s *Scratch) buildCTable() error { lowN++ } - huffNode[nodeNb].count = huffNode0[n1+1].count + huffNode0[n2+1].count - huffNode0[n1+1].parent, huffNode0[n2+1].parent = uint16(nodeNb), uint16(nodeNb) + huffNode[nodeNb].setCount(huffNode0[n1+1].count() + huffNode0[n2+1].count()) + huffNode0[n1+1].setParent(nodeNb) + huffNode0[n2+1].setParent(nodeNb) nodeNb++ } // distribute weights (unlimited tree height) - huffNode[nodeRoot].nbBits = 0 + huffNode[nodeRoot].setNbBits(0) for n := nodeRoot - 1; n >= startNode; n-- { - huffNode[n].nbBits = huffNode[huffNode[n].parent].nbBits + 1 + huffNode[n].setNbBits(huffNode[huffNode[n].parent()].nbBits() + 1) } for n := uint16(0); n <= nonNullRank; n++ { - huffNode[n].nbBits = huffNode[huffNode[n].parent].nbBits + 1 + huffNode[n].setNbBits(huffNode[huffNode[n].parent()].nbBits() + 1) } s.actualTableLog = s.setMaxHeight(int(nonNullRank)) maxNbBits := s.actualTableLog @@ -542,7 +544,7 @@ func (s *Scratch) buildCTable() error { var nbPerRank [tableLogMax + 1]uint16 var valPerRank [16]uint16 for _, v := range huffNode[:nonNullRank+1] { - nbPerRank[v.nbBits]++ + nbPerRank[v.nbBits()]++ } // determine stating value per rank { @@ -557,7 +559,7 @@ func (s *Scratch) buildCTable() error { // push nbBits per symbol, symbol order for _, v := range huffNode[:nonNullRank+1] { - s.cTable[v.symbol].nBits = v.nbBits + s.cTable[v.symbol()].nBits = v.nbBits() } // assign value within rank, symbol order @@ -603,12 +605,12 @@ func (s *Scratch) huffSort() { pos := rank[r].current rank[r].current++ prev := nodes[(pos-1)&huffNodesMask] - for pos > rank[r].base && c > prev.count { + for pos > rank[r].base && c > prev.count() { nodes[pos&huffNodesMask] = prev pos-- prev = nodes[(pos-1)&huffNodesMask] } - nodes[pos&huffNodesMask] = nodeElt{count: c, symbol: byte(n)} + nodes[pos&huffNodesMask] = makeNodeElt(c, byte(n)) } } @@ -617,7 +619,7 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { huffNode := s.nodes[1 : huffNodesLen+1] //huffNode = huffNode[: huffNodesLen] - largestBits := huffNode[lastNonNull].nbBits + largestBits := huffNode[lastNonNull].nbBits() // early exit : no elt > maxNbBits if largestBits <= maxNbBits { @@ -627,14 +629,14 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { baseCost := int(1) << (largestBits - maxNbBits) n := uint32(lastNonNull) - for huffNode[n].nbBits > maxNbBits { - totalCost += baseCost - (1 << (largestBits - huffNode[n].nbBits)) - huffNode[n].nbBits = maxNbBits + for huffNode[n].nbBits() > maxNbBits { + totalCost += baseCost - (1 << (largestBits - huffNode[n].nbBits())) + huffNode[n].setNbBits(maxNbBits) n-- } // n stops at huffNode[n].nbBits <= maxNbBits - for huffNode[n].nbBits == maxNbBits { + for huffNode[n].nbBits() == maxNbBits { n-- } // n end at index of smallest symbol using < maxNbBits @@ -655,10 +657,10 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { { currentNbBits := maxNbBits for pos := int(n); pos >= 0; pos-- { - if huffNode[pos].nbBits >= currentNbBits { + if huffNode[pos].nbBits() >= currentNbBits { continue } - currentNbBits = huffNode[pos].nbBits // < maxNbBits + currentNbBits = huffNode[pos].nbBits() // < maxNbBits rankLast[maxNbBits-currentNbBits] = uint32(pos) } } @@ -675,8 +677,8 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { if lowPos == noSymbol { break } - highTotal := huffNode[highPos].count - lowTotal := 2 * huffNode[lowPos].count + highTotal := huffNode[highPos].count() + lowTotal := 2 * huffNode[lowPos].count() if highTotal <= lowTotal { break } @@ -692,13 +694,14 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { // this rank is no longer empty rankLast[nBitsToDecrease-1] = rankLast[nBitsToDecrease] } - huffNode[rankLast[nBitsToDecrease]].nbBits++ + huffNode[rankLast[nBitsToDecrease]].setNbBits(1 + + huffNode[rankLast[nBitsToDecrease]].nbBits()) if rankLast[nBitsToDecrease] == 0 { /* special case, reached largest symbol */ rankLast[nBitsToDecrease] = noSymbol } else { rankLast[nBitsToDecrease]-- - if huffNode[rankLast[nBitsToDecrease]].nbBits != maxNbBits-nBitsToDecrease { + if huffNode[rankLast[nBitsToDecrease]].nbBits() != maxNbBits-nBitsToDecrease { rankLast[nBitsToDecrease] = noSymbol /* this rank is now empty */ } } @@ -706,15 +709,15 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { for totalCost < 0 { /* Sometimes, cost correction overshoot */ if rankLast[1] == noSymbol { /* special case : no rank 1 symbol (using maxNbBits-1); let's create one from largest rank 0 (using maxNbBits) */ - for huffNode[n].nbBits == maxNbBits { + for huffNode[n].nbBits() == maxNbBits { n-- } - huffNode[n+1].nbBits-- + huffNode[n+1].setNbBits(huffNode[n+1].nbBits() - 1) rankLast[1] = n + 1 totalCost++ continue } - huffNode[rankLast[1]+1].nbBits-- + huffNode[rankLast[1]+1].setNbBits(huffNode[rankLast[1]+1].nbBits() - 1) rankLast[1]++ totalCost++ } @@ -722,9 +725,26 @@ func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { return maxNbBits } -type nodeElt struct { - count uint32 - parent uint16 - symbol byte - nbBits uint8 +// A nodeElt is the fields +// +// count uint32 +// parent uint16 +// symbol byte +// nbBits uint8 +// +// in some order, all squashed into an integer so that the compiler +// always loads and stores entire nodeElts instead of separate fields. +type nodeElt uint64 + +func makeNodeElt(count uint32, symbol byte) nodeElt { + return nodeElt(count) | nodeElt(symbol)<<48 } + +func (e *nodeElt) count() uint32 { return uint32(*e) } +func (e *nodeElt) parent() uint16 { return uint16(*e >> 32) } +func (e *nodeElt) symbol() byte { return byte(*e >> 48) } +func (e *nodeElt) nbBits() uint8 { return uint8(*e >> 56) } + +func (e *nodeElt) setCount(c uint32) { *e = (*e)&0xffffffff00000000 | nodeElt(c) } +func (e *nodeElt) setParent(p int16) { *e = (*e)&0xffff0000ffffffff | nodeElt(uint16(p))<<32 } +func (e *nodeElt) setNbBits(n uint8) { *e = (*e)&0x00ffffffffffffff | nodeElt(n)<<56 } diff --git a/vendor/github.com/klauspost/compress/huff0/decompress.go b/vendor/github.com/klauspost/compress/huff0/decompress.go index c0c48bd7..3c0b398c 100644 --- a/vendor/github.com/klauspost/compress/huff0/decompress.go +++ b/vendor/github.com/klauspost/compress/huff0/decompress.go @@ -61,7 +61,7 @@ func ReadTable(in []byte, s *Scratch) (s2 *Scratch, remain []byte, err error) { b, err := fse.Decompress(in[:iSize], s.fse) s.fse.Out = nil if err != nil { - return s, nil, err + return s, nil, fmt.Errorf("fse decompress returned: %w", err) } if len(b) > 255 { return s, nil, errors.New("corrupt input: output table too large") @@ -763,17 +763,20 @@ func (d *Decoder) decompress4X8bit(dst, src []byte) ([]byte, error) { d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 1") } - copy(out, buf[0][:]) - copy(out[dstEvery:], buf[1][:]) - copy(out[dstEvery*2:], buf[2][:]) - copy(out[dstEvery*3:], buf[3][:]) - out = out[bufoff:] - decoded += bufoff * 4 // There must at least be 3 buffers left. - if len(out) < dstEvery*3 { + if len(out)-bufoff < dstEvery*3 { d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 2") } + //copy(out, buf[0][:]) + //copy(out[dstEvery:], buf[1][:]) + //copy(out[dstEvery*2:], buf[2][:]) + *(*[bufoff]byte)(out) = buf[0] + *(*[bufoff]byte)(out[dstEvery:]) = buf[1] + *(*[bufoff]byte)(out[dstEvery*2:]) = buf[2] + *(*[bufoff]byte)(out[dstEvery*3:]) = buf[3] + out = out[bufoff:] + decoded += bufoff * 4 } } if off > 0 { @@ -997,17 +1000,22 @@ func (d *Decoder) decompress4X8bitExactly(dst, src []byte) ([]byte, error) { d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 1") } - copy(out, buf[0][:]) - copy(out[dstEvery:], buf[1][:]) - copy(out[dstEvery*2:], buf[2][:]) - copy(out[dstEvery*3:], buf[3][:]) - out = out[bufoff:] - decoded += bufoff * 4 // There must at least be 3 buffers left. - if len(out) < dstEvery*3 { + if len(out)-bufoff < dstEvery*3 { d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 2") } + + //copy(out, buf[0][:]) + //copy(out[dstEvery:], buf[1][:]) + //copy(out[dstEvery*2:], buf[2][:]) + // copy(out[dstEvery*3:], buf[3][:]) + *(*[bufoff]byte)(out) = buf[0] + *(*[bufoff]byte)(out[dstEvery:]) = buf[1] + *(*[bufoff]byte)(out[dstEvery*2:]) = buf[2] + *(*[bufoff]byte)(out[dstEvery*3:]) = buf[3] + out = out[bufoff:] + decoded += bufoff * 4 } } if off > 0 { diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go index 9f3e9f79..ba7e8e6b 100644 --- a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go +++ b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go @@ -14,12 +14,14 @@ import ( // decompress4x_main_loop_x86 is an x86 assembler implementation // of Decompress4X when tablelog > 8. +// //go:noescape func decompress4x_main_loop_amd64(ctx *decompress4xContext) // decompress4x_8b_loop_x86 is an x86 assembler implementation // of Decompress4X when tablelog <= 8 which decodes 4 entries // per loop. +// //go:noescape func decompress4x_8b_main_loop_amd64(ctx *decompress4xContext) @@ -145,11 +147,13 @@ func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { // decompress4x_main_loop_x86 is an x86 assembler implementation // of Decompress1X when tablelog > 8. +// //go:noescape func decompress1x_main_loop_amd64(ctx *decompress1xContext) // decompress4x_main_loop_x86 is an x86 with BMI2 assembler implementation // of Decompress1X when tablelog > 8. +// //go:noescape func decompress1x_main_loop_bmi2(ctx *decompress1xContext) diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s index dd1a5aec..c4c7ab2d 100644 --- a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s +++ b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s @@ -1,364 +1,352 @@ // Code generated by command: go run gen.go -out ../decompress_amd64.s -pkg=huff0. DO NOT EDIT. //go:build amd64 && !appengine && !noasm && gc -// +build amd64,!appengine,!noasm,gc // func decompress4x_main_loop_amd64(ctx *decompress4xContext) TEXT ·decompress4x_main_loop_amd64(SB), $0-8 - XORQ DX, DX - // Preload values MOVQ ctx+0(FP), AX MOVBQZX 8(AX), DI - MOVQ 16(AX), SI - MOVQ 48(AX), BX - MOVQ 24(AX), R9 - MOVQ 32(AX), R10 - MOVQ (AX), R11 + MOVQ 16(AX), BX + MOVQ 48(AX), SI + MOVQ 24(AX), R8 + MOVQ 32(AX), R9 + MOVQ (AX), R10 // Main loop main_loop: - MOVQ SI, R8 - CMPQ R8, BX + XORL DX, DX + CMPQ BX, SI SETGE DL // br0.fillFast32() - MOVQ 32(R11), R12 - MOVBQZX 40(R11), R13 - CMPQ R13, $0x20 + MOVQ 32(R10), R11 + MOVBQZX 40(R10), R12 + CMPQ R12, $0x20 JBE skip_fill0 - MOVQ 24(R11), AX - SUBQ $0x20, R13 + MOVQ 24(R10), AX + SUBQ $0x20, R12 SUBQ $0x04, AX - MOVQ (R11), R14 + MOVQ (R10), R13 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (AX)(R14*1), R14 - MOVQ R13, CX - SHLQ CL, R14 - MOVQ AX, 24(R11) - ORQ R14, R12 + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 24(R10) + ORQ R13, R11 - // exhausted = exhausted || (br0.off < 4) - CMPQ AX, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br0.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL skip_fill0: // val0 := br0.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br0.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br0.peekTopBits(peekBits) MOVQ DI, CX - MOVQ R12, R14 - SHRQ CL, R14 + MOVQ R11, R13 + SHRQ CL, R13 // v1 := table[val1&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br0.advance(uint8(v1.entry)) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // these two writes get coalesced // out[id * dstEvery + 0] = uint8(v0.entry >> 8) // out[id * dstEvery + 1] = uint8(v1.entry >> 8) - MOVW AX, (R8) + MOVW AX, (BX) // update the bitreader structure - MOVQ R12, 32(R11) - MOVB R13, 40(R11) - ADDQ R9, R8 + MOVQ R11, 32(R10) + MOVB R12, 40(R10) // br1.fillFast32() - MOVQ 80(R11), R12 - MOVBQZX 88(R11), R13 - CMPQ R13, $0x20 + MOVQ 80(R10), R11 + MOVBQZX 88(R10), R12 + CMPQ R12, $0x20 JBE skip_fill1 - MOVQ 72(R11), AX - SUBQ $0x20, R13 + MOVQ 72(R10), AX + SUBQ $0x20, R12 SUBQ $0x04, AX - MOVQ 48(R11), R14 + MOVQ 48(R10), R13 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (AX)(R14*1), R14 - MOVQ R13, CX - SHLQ CL, R14 - MOVQ AX, 72(R11) - ORQ R14, R12 + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 72(R10) + ORQ R13, R11 - // exhausted = exhausted || (br1.off < 4) - CMPQ AX, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br1.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL skip_fill1: // val0 := br1.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br1.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br1.peekTopBits(peekBits) MOVQ DI, CX - MOVQ R12, R14 - SHRQ CL, R14 + MOVQ R11, R13 + SHRQ CL, R13 // v1 := table[val1&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br1.advance(uint8(v1.entry)) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // these two writes get coalesced // out[id * dstEvery + 0] = uint8(v0.entry >> 8) // out[id * dstEvery + 1] = uint8(v1.entry >> 8) - MOVW AX, (R8) + MOVW AX, (BX)(R8*1) // update the bitreader structure - MOVQ R12, 80(R11) - MOVB R13, 88(R11) - ADDQ R9, R8 + MOVQ R11, 80(R10) + MOVB R12, 88(R10) // br2.fillFast32() - MOVQ 128(R11), R12 - MOVBQZX 136(R11), R13 - CMPQ R13, $0x20 + MOVQ 128(R10), R11 + MOVBQZX 136(R10), R12 + CMPQ R12, $0x20 JBE skip_fill2 - MOVQ 120(R11), AX - SUBQ $0x20, R13 + MOVQ 120(R10), AX + SUBQ $0x20, R12 SUBQ $0x04, AX - MOVQ 96(R11), R14 + MOVQ 96(R10), R13 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (AX)(R14*1), R14 - MOVQ R13, CX - SHLQ CL, R14 - MOVQ AX, 120(R11) - ORQ R14, R12 + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 120(R10) + ORQ R13, R11 - // exhausted = exhausted || (br2.off < 4) - CMPQ AX, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br2.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL skip_fill2: // val0 := br2.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br2.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br2.peekTopBits(peekBits) MOVQ DI, CX - MOVQ R12, R14 - SHRQ CL, R14 + MOVQ R11, R13 + SHRQ CL, R13 // v1 := table[val1&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br2.advance(uint8(v1.entry)) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // these two writes get coalesced // out[id * dstEvery + 0] = uint8(v0.entry >> 8) // out[id * dstEvery + 1] = uint8(v1.entry >> 8) - MOVW AX, (R8) + MOVW AX, (BX)(R8*2) // update the bitreader structure - MOVQ R12, 128(R11) - MOVB R13, 136(R11) - ADDQ R9, R8 + MOVQ R11, 128(R10) + MOVB R12, 136(R10) // br3.fillFast32() - MOVQ 176(R11), R12 - MOVBQZX 184(R11), R13 - CMPQ R13, $0x20 + MOVQ 176(R10), R11 + MOVBQZX 184(R10), R12 + CMPQ R12, $0x20 JBE skip_fill3 - MOVQ 168(R11), AX - SUBQ $0x20, R13 + MOVQ 168(R10), AX + SUBQ $0x20, R12 SUBQ $0x04, AX - MOVQ 144(R11), R14 + MOVQ 144(R10), R13 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (AX)(R14*1), R14 - MOVQ R13, CX - SHLQ CL, R14 - MOVQ AX, 168(R11) - ORQ R14, R12 + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 168(R10) + ORQ R13, R11 - // exhausted = exhausted || (br3.off < 4) - CMPQ AX, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br3.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL skip_fill3: // val0 := br3.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br3.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br3.peekTopBits(peekBits) MOVQ DI, CX - MOVQ R12, R14 - SHRQ CL, R14 + MOVQ R11, R13 + SHRQ CL, R13 // v1 := table[val1&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br3.advance(uint8(v1.entry)) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // these two writes get coalesced // out[id * dstEvery + 0] = uint8(v0.entry >> 8) // out[id * dstEvery + 1] = uint8(v1.entry >> 8) - MOVW AX, (R8) + LEAQ (R8)(R8*2), CX + MOVW AX, (BX)(CX*1) // update the bitreader structure - MOVQ R12, 176(R11) - MOVB R13, 184(R11) - ADDQ $0x02, SI + MOVQ R11, 176(R10) + MOVB R12, 184(R10) + ADDQ $0x02, BX TESTB DL, DL JZ main_loop MOVQ ctx+0(FP), AX - SUBQ 16(AX), SI - SHLQ $0x02, SI - MOVQ SI, 40(AX) + SUBQ 16(AX), BX + SHLQ $0x02, BX + MOVQ BX, 40(AX) RET // func decompress4x_8b_main_loop_amd64(ctx *decompress4xContext) TEXT ·decompress4x_8b_main_loop_amd64(SB), $0-8 - XORQ DX, DX - // Preload values MOVQ ctx+0(FP), CX MOVBQZX 8(CX), DI MOVQ 16(CX), BX MOVQ 48(CX), SI - MOVQ 24(CX), R9 - MOVQ 32(CX), R10 - MOVQ (CX), R11 + MOVQ 24(CX), R8 + MOVQ 32(CX), R9 + MOVQ (CX), R10 // Main loop main_loop: - MOVQ BX, R8 - CMPQ R8, SI + XORL DX, DX + CMPQ BX, SI SETGE DL // br0.fillFast32() - MOVQ 32(R11), R12 - MOVBQZX 40(R11), R13 - CMPQ R13, $0x20 + MOVQ 32(R10), R11 + MOVBQZX 40(R10), R12 + CMPQ R12, $0x20 JBE skip_fill0 - MOVQ 24(R11), R14 - SUBQ $0x20, R13 - SUBQ $0x04, R14 - MOVQ (R11), R15 + MOVQ 24(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ (R10), R14 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (R14)(R15*1), R15 - MOVQ R13, CX - SHLQ CL, R15 - MOVQ R14, 24(R11) - ORQ R15, R12 + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 24(R10) + ORQ R14, R11 - // exhausted = exhausted || (br0.off < 4) - CMPQ R14, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br0.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL skip_fill0: // val0 := br0.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br0.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br0.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v1 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br0.advance(uint8(v1.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // val2 := br0.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v2 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br0.advance(uint8(v2.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val3 := br0.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v3 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br0.advance(uint8(v3.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // these four writes get coalesced @@ -366,88 +354,86 @@ skip_fill0: // out[id * dstEvery + 1] = uint8(v1.entry >> 8) // out[id * dstEvery + 3] = uint8(v2.entry >> 8) // out[id * dstEvery + 4] = uint8(v3.entry >> 8) - MOVL AX, (R8) + MOVL AX, (BX) // update the bitreader structure - MOVQ R12, 32(R11) - MOVB R13, 40(R11) - ADDQ R9, R8 + MOVQ R11, 32(R10) + MOVB R12, 40(R10) // br1.fillFast32() - MOVQ 80(R11), R12 - MOVBQZX 88(R11), R13 - CMPQ R13, $0x20 + MOVQ 80(R10), R11 + MOVBQZX 88(R10), R12 + CMPQ R12, $0x20 JBE skip_fill1 - MOVQ 72(R11), R14 - SUBQ $0x20, R13 - SUBQ $0x04, R14 - MOVQ 48(R11), R15 + MOVQ 72(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ 48(R10), R14 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (R14)(R15*1), R15 - MOVQ R13, CX - SHLQ CL, R15 - MOVQ R14, 72(R11) - ORQ R15, R12 + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 72(R10) + ORQ R14, R11 - // exhausted = exhausted || (br1.off < 4) - CMPQ R14, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br1.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL skip_fill1: // val0 := br1.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br1.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br1.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v1 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br1.advance(uint8(v1.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // val2 := br1.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v2 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br1.advance(uint8(v2.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val3 := br1.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v3 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br1.advance(uint8(v3.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // these four writes get coalesced @@ -455,88 +441,86 @@ skip_fill1: // out[id * dstEvery + 1] = uint8(v1.entry >> 8) // out[id * dstEvery + 3] = uint8(v2.entry >> 8) // out[id * dstEvery + 4] = uint8(v3.entry >> 8) - MOVL AX, (R8) + MOVL AX, (BX)(R8*1) // update the bitreader structure - MOVQ R12, 80(R11) - MOVB R13, 88(R11) - ADDQ R9, R8 + MOVQ R11, 80(R10) + MOVB R12, 88(R10) // br2.fillFast32() - MOVQ 128(R11), R12 - MOVBQZX 136(R11), R13 - CMPQ R13, $0x20 + MOVQ 128(R10), R11 + MOVBQZX 136(R10), R12 + CMPQ R12, $0x20 JBE skip_fill2 - MOVQ 120(R11), R14 - SUBQ $0x20, R13 - SUBQ $0x04, R14 - MOVQ 96(R11), R15 + MOVQ 120(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ 96(R10), R14 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (R14)(R15*1), R15 - MOVQ R13, CX - SHLQ CL, R15 - MOVQ R14, 120(R11) - ORQ R15, R12 + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 120(R10) + ORQ R14, R11 - // exhausted = exhausted || (br2.off < 4) - CMPQ R14, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br2.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL skip_fill2: // val0 := br2.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br2.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br2.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v1 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br2.advance(uint8(v1.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // val2 := br2.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v2 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br2.advance(uint8(v2.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val3 := br2.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v3 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br2.advance(uint8(v3.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // these four writes get coalesced @@ -544,88 +528,86 @@ skip_fill2: // out[id * dstEvery + 1] = uint8(v1.entry >> 8) // out[id * dstEvery + 3] = uint8(v2.entry >> 8) // out[id * dstEvery + 4] = uint8(v3.entry >> 8) - MOVL AX, (R8) + MOVL AX, (BX)(R8*2) // update the bitreader structure - MOVQ R12, 128(R11) - MOVB R13, 136(R11) - ADDQ R9, R8 + MOVQ R11, 128(R10) + MOVB R12, 136(R10) // br3.fillFast32() - MOVQ 176(R11), R12 - MOVBQZX 184(R11), R13 - CMPQ R13, $0x20 + MOVQ 176(R10), R11 + MOVBQZX 184(R10), R12 + CMPQ R12, $0x20 JBE skip_fill3 - MOVQ 168(R11), R14 - SUBQ $0x20, R13 - SUBQ $0x04, R14 - MOVQ 144(R11), R15 + MOVQ 168(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ 144(R10), R14 // b.value |= uint64(low) << (b.bitsRead & 63) - MOVL (R14)(R15*1), R15 - MOVQ R13, CX - SHLQ CL, R15 - MOVQ R14, 168(R11) - ORQ R15, R12 + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 168(R10) + ORQ R14, R11 - // exhausted = exhausted || (br3.off < 4) - CMPQ R14, $0x04 - SETLT AL - ORB AL, DL + // exhausted += (br3.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL skip_fill3: // val0 := br3.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v0 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br3.advance(uint8(v0.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val1 := br3.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v1 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br3.advance(uint8(v1.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // val2 := br3.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v2 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br3.advance(uint8(v2.entry) MOVB CH, AH - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 // val3 := br3.peekTopBits(peekBits) - MOVQ R12, R14 + MOVQ R11, R13 MOVQ DI, CX - SHRQ CL, R14 + SHRQ CL, R13 // v3 := table[val0&mask] - MOVW (R10)(R14*2), CX + MOVW (R9)(R13*2), CX // br3.advance(uint8(v3.entry) MOVB CH, AL - SHLQ CL, R12 - ADDB CL, R13 + SHLQ CL, R11 + ADDB CL, R12 BSWAPL AX // these four writes get coalesced @@ -633,11 +615,12 @@ skip_fill3: // out[id * dstEvery + 1] = uint8(v1.entry >> 8) // out[id * dstEvery + 3] = uint8(v2.entry >> 8) // out[id * dstEvery + 4] = uint8(v3.entry >> 8) - MOVL AX, (R8) + LEAQ (R8)(R8*2), CX + MOVL AX, (BX)(CX*1) // update the bitreader structure - MOVQ R12, 176(R11) - MOVB R13, 184(R11) + MOVQ R11, 176(R10) + MOVB R12, 184(R10) ADDQ $0x04, BX TESTB DL, DL JZ main_loop @@ -653,7 +636,7 @@ TEXT ·decompress1x_main_loop_amd64(SB), $0-8 MOVQ 16(CX), DX MOVQ 24(CX), BX CMPQ BX, $0x04 - JB error_max_decoded_size_exeeded + JB error_max_decoded_size_exceeded LEAQ (DX)(BX*1), BX MOVQ (CX), SI MOVQ (SI), R8 @@ -668,7 +651,7 @@ main_loop: // Check if we have room for 4 bytes in the output buffer LEAQ 4(DX), CX CMPQ CX, BX - JGE error_max_decoded_size_exeeded + JGE error_max_decoded_size_exceeded // Decode 4 values CMPQ R11, $0x20 @@ -745,7 +728,7 @@ loop_condition: RET // Report error -error_max_decoded_size_exeeded: +error_max_decoded_size_exceeded: MOVQ ctx+0(FP), AX MOVQ $-1, CX MOVQ CX, 40(AX) @@ -758,7 +741,7 @@ TEXT ·decompress1x_main_loop_bmi2(SB), $0-8 MOVQ 16(CX), DX MOVQ 24(CX), BX CMPQ BX, $0x04 - JB error_max_decoded_size_exeeded + JB error_max_decoded_size_exceeded LEAQ (DX)(BX*1), BX MOVQ (CX), SI MOVQ (SI), R8 @@ -773,7 +756,7 @@ main_loop: // Check if we have room for 4 bytes in the output buffer LEAQ 4(DX), CX CMPQ CX, BX - JGE error_max_decoded_size_exeeded + JGE error_max_decoded_size_exceeded // Decode 4 values CMPQ R11, $0x20 @@ -840,7 +823,7 @@ loop_condition: RET // Report error -error_max_decoded_size_exeeded: +error_max_decoded_size_exceeded: MOVQ ctx+0(FP), AX MOVQ $-1, CX MOVQ CX, 40(AX) diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_generic.go b/vendor/github.com/klauspost/compress/huff0/decompress_generic.go index 4f6f37cb..908c17de 100644 --- a/vendor/github.com/klauspost/compress/huff0/decompress_generic.go +++ b/vendor/github.com/klauspost/compress/huff0/decompress_generic.go @@ -122,17 +122,21 @@ func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 1") } - copy(out, buf[0][:]) - copy(out[dstEvery:], buf[1][:]) - copy(out[dstEvery*2:], buf[2][:]) - copy(out[dstEvery*3:], buf[3][:]) - out = out[bufoff:] - decoded += bufoff * 4 // There must at least be 3 buffers left. - if len(out) < dstEvery*3 { + if len(out)-bufoff < dstEvery*3 { d.bufs.Put(buf) return nil, errors.New("corruption detected: stream overrun 2") } + //copy(out, buf[0][:]) + //copy(out[dstEvery:], buf[1][:]) + //copy(out[dstEvery*2:], buf[2][:]) + //copy(out[dstEvery*3:], buf[3][:]) + *(*[bufoff]byte)(out) = buf[0] + *(*[bufoff]byte)(out[dstEvery:]) = buf[1] + *(*[bufoff]byte)(out[dstEvery*2:]) = buf[2] + *(*[bufoff]byte)(out[dstEvery*3:]) = buf[3] + out = out[bufoff:] + decoded += bufoff * 4 } } if off > 0 { diff --git a/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go index 511bba65..05db94d3 100644 --- a/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go +++ b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go @@ -18,6 +18,7 @@ func load64(b []byte, i int) uint64 { // emitLiteral writes a literal chunk and returns the number of bytes written. // // It assumes that: +// // dst is long enough to hold the encoded bytes // 1 <= len(lit) && len(lit) <= 65536 func emitLiteral(dst, lit []byte) int { @@ -42,6 +43,7 @@ func emitLiteral(dst, lit []byte) int { // emitCopy writes a copy chunk and returns the number of bytes written. // // It assumes that: +// // dst is long enough to hold the encoded bytes // 1 <= offset && offset <= 65535 // 4 <= length && length <= 65535 @@ -89,6 +91,7 @@ func emitCopy(dst []byte, offset, length int) int { // src[i:i+k-j] and src[j:k] have the same contents. // // It assumes that: +// // 0 <= i && i < j && j <= len(src) func extendMatch(src []byte, i, j int) int { for ; j < len(src) && src[i] == src[j]; i, j = i+1, j+1 { @@ -100,13 +103,36 @@ func hash(u, shift uint32) uint32 { return (u * 0x1e35a7bd) >> shift } +// EncodeBlockInto exposes encodeBlock but checks dst size. +func EncodeBlockInto(dst, src []byte) (d int) { + if MaxEncodedLen(len(src)) > len(dst) { + return 0 + } + + // encodeBlock breaks on too big blocks, so split. + for len(src) > 0 { + p := src + src = nil + if len(p) > maxBlockSize { + p, src = p[:maxBlockSize], p[maxBlockSize:] + } + if len(p) < minNonLiteralBlockSize { + d += emitLiteral(dst[d:], p) + } else { + d += encodeBlock(dst[d:], p) + } + } + return d +} + // encodeBlock encodes a non-empty src to a guaranteed-large-enough dst. It // assumes that the varint-encoded length of the decompressed bytes has already // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlock(dst, src []byte) (d int) { // Initialize the hash table. Its size ranges from 1<<8 to 1<<14 inclusive. // The table element type is uint16, as s < sLimit and sLimit < len(src) diff --git a/vendor/github.com/klauspost/compress/s2/README.md b/vendor/github.com/klauspost/compress/s2/README.md index 73c0c462..8284bb08 100644 --- a/vendor/github.com/klauspost/compress/s2/README.md +++ b/vendor/github.com/klauspost/compress/s2/README.md @@ -20,11 +20,12 @@ This is important, so you don't have to worry about spending CPU cycles on alrea * Concurrent stream compression * Faster decompression, even for Snappy compatible content * Concurrent Snappy/S2 stream decompression -* Ability to quickly skip forward in compressed stream +* Skip forward in compressed stream * Random seeking with indexes * Compatible with reading Snappy compressed content * Smaller block size overhead on incompressible blocks * Block concatenation +* Block Dictionary support * Uncompressed stream mode * Automatic stream size padding * Snappy compatible block compression @@ -325,35 +326,35 @@ The content compressed in this mode is fully compatible with the standard decode Snappy vs S2 **compression** speed on 16 core (32 thread) computer, using all threads and a single thread (1 CPU): -| File | S2 speed | S2 Throughput | S2 % smaller | S2 "better" | "better" throughput | "better" % smaller | -|-----------------------------------------------------------------------------------------------------|----------|---------------|--------------|-------------|---------------------|--------------------| -| [rawstudio-mint14.tar](https://files.klauspost.com/compress/rawstudio-mint14.7z) | 12.70x | 10556 MB/s | 7.35% | 4.15x | 3455 MB/s | 12.79% | -| (1 CPU) | 1.14x | 948 MB/s | - | 0.42x | 349 MB/s | - | -| [github-june-2days-2019.json](https://files.klauspost.com/compress/github-june-2days-2019.json.zst) | 17.13x | 14484 MB/s | 31.60% | 10.09x | 8533 MB/s | 37.71% | -| (1 CPU) | 1.33x | 1127 MB/s | - | 0.70x | 589 MB/s | - | -| [github-ranks-backup.bin](https://files.klauspost.com/compress/github-ranks-backup.bin.zst) | 15.14x | 12000 MB/s | -5.79% | 6.59x | 5223 MB/s | 5.80% | -| (1 CPU) | 1.11x | 877 MB/s | - | 0.47x | 370 MB/s | - | -| [consensus.db.10gb](https://files.klauspost.com/compress/consensus.db.10gb.zst) | 14.62x | 12116 MB/s | 15.90% | 5.35x | 4430 MB/s | 16.08% | -| (1 CPU) | 1.38x | 1146 MB/s | - | 0.38x | 312 MB/s | - | -| [adresser.json](https://files.klauspost.com/compress/adresser.json.zst) | 8.83x | 17579 MB/s | 43.86% | 6.54x | 13011 MB/s | 47.23% | -| (1 CPU) | 1.14x | 2259 MB/s | - | 0.74x | 1475 MB/s | - | -| [gob-stream](https://files.klauspost.com/compress/gob-stream.7z) | 16.72x | 14019 MB/s | 24.02% | 10.11x | 8477 MB/s | 30.48% | -| (1 CPU) | 1.24x | 1043 MB/s | - | 0.70x | 586 MB/s | - | -| [10gb.tar](http://mattmahoney.net/dc/10gb.html) | 13.33x | 9254 MB/s | 1.84% | 6.75x | 4686 MB/s | 6.72% | -| (1 CPU) | 0.97x | 672 MB/s | - | 0.53x | 366 MB/s | - | -| sharnd.out.2gb | 2.11x | 12639 MB/s | 0.01% | 1.98x | 11833 MB/s | 0.01% | -| (1 CPU) | 0.93x | 5594 MB/s | - | 1.34x | 8030 MB/s | - | -| [enwik9](http://mattmahoney.net/dc/textdata.html) | 19.34x | 8220 MB/s | 3.98% | 7.87x | 3345 MB/s | 15.82% | -| (1 CPU) | 1.06x | 452 MB/s | - | 0.50x | 213 MB/s | - | -| [silesia.tar](http://sun.aei.polsl.pl/~sdeor/corpus/silesia.zip) | 10.48x | 6124 MB/s | 5.67% | 3.76x | 2197 MB/s | 12.60% | -| (1 CPU) | 0.97x | 568 MB/s | - | 0.46x | 271 MB/s | - | -| [enwik10](https://encode.su/threads/3315-enwik10-benchmark-results) | 21.07x | 9020 MB/s | 6.36% | 6.91x | 2959 MB/s | 16.95% | -| (1 CPU) | 1.07x | 460 MB/s | - | 0.51x | 220 MB/s | - | +| File | S2 Speed | S2 Throughput | S2 % smaller | S2 "better" | "better" throughput | "better" % smaller | +|---------------------------------------------------------------------------------------------------------|----------|---------------|--------------|-------------|---------------------|--------------------| +| [rawstudio-mint14.tar](https://files.klauspost.com/compress/rawstudio-mint14.7z) | 16.33x | 10556 MB/s | 8.0% | 6.04x | 5252 MB/s | 14.7% | +| (1 CPU) | 1.08x | 940 MB/s | - | 0.46x | 400 MB/s | - | +| [github-june-2days-2019.json](https://files.klauspost.com/compress/github-june-2days-2019.json.zst) | 16.51x | 15224 MB/s | 31.70% | 9.47x | 8734 MB/s | 37.71% | +| (1 CPU) | 1.26x | 1157 MB/s | - | 0.60x | 556 MB/s | - | +| [github-ranks-backup.bin](https://files.klauspost.com/compress/github-ranks-backup.bin.zst) | 15.14x | 12598 MB/s | -5.76% | 6.23x | 5675 MB/s | 3.62% | +| (1 CPU) | 1.02x | 932 MB/s | - | 0.47x | 432 MB/s | - | +| [consensus.db.10gb](https://files.klauspost.com/compress/consensus.db.10gb.zst) | 11.21x | 12116 MB/s | 15.95% | 3.24x | 3500 MB/s | 18.00% | +| (1 CPU) | 1.05x | 1135 MB/s | - | 0.27x | 292 MB/s | - | +| [apache.log](https://files.klauspost.com/compress/apache.log.zst) | 8.55x | 16673 MB/s | 20.54% | 5.85x | 11420 MB/s | 24.97% | +| (1 CPU) | 1.91x | 1771 MB/s | - | 0.53x | 1041 MB/s | - | +| [gob-stream](https://files.klauspost.com/compress/gob-stream.7z) | 15.76x | 14357 MB/s | 24.01% | 8.67x | 7891 MB/s | 33.68% | +| (1 CPU) | 1.17x | 1064 MB/s | - | 0.65x | 595 MB/s | - | +| [10gb.tar](http://mattmahoney.net/dc/10gb.html) | 13.33x | 9835 MB/s | 2.34% | 6.85x | 4863 MB/s | 9.96% | +| (1 CPU) | 0.97x | 689 MB/s | - | 0.55x | 387 MB/s | - | +| sharnd.out.2gb | 9.11x | 13213 MB/s | 0.01% | 1.49x | 9184 MB/s | 0.01% | +| (1 CPU) | 0.88x | 5418 MB/s | - | 0.77x | 5417 MB/s | - | +| [sofia-air-quality-dataset csv](https://files.klauspost.com/compress/sofia-air-quality-dataset.tar.zst) | 22.00x | 11477 MB/s | 18.73% | 11.15x | 5817 MB/s | 27.88% | +| (1 CPU) | 1.23x | 642 MB/s | - | 0.71x | 642 MB/s | - | +| [silesia.tar](http://sun.aei.polsl.pl/~sdeor/corpus/silesia.zip) | 11.23x | 6520 MB/s | 5.9% | 5.35x | 3109 MB/s | 15.88% | +| (1 CPU) | 1.05x | 607 MB/s | - | 0.52x | 304 MB/s | - | +| [enwik9](https://files.klauspost.com/compress/enwik9.zst) | 19.28x | 8440 MB/s | 4.04% | 9.31x | 4076 MB/s | 18.04% | +| (1 CPU) | 1.12x | 488 MB/s | - | 0.57x | 250 MB/s | - | ### Legend -* `S2 speed`: Speed of S2 compared to Snappy, using 16 cores and 1 core. -* `S2 throughput`: Throughput of S2 in MB/s. +* `S2 Speed`: Speed of S2 compared to Snappy, using 16 cores and 1 core. +* `S2 Throughput`: Throughput of S2 in MB/s. * `S2 % smaller`: How many percent of the Snappy output size is S2 better. * `S2 "better"`: Speed when enabling "better" compression mode in S2 compared to Snappy. * `"better" throughput`: Speed when enabling "better" compression mode in S2 compared to Snappy. @@ -361,7 +362,7 @@ Snappy vs S2 **compression** speed on 16 core (32 thread) computer, using all th There is a good speedup across the board when using a single thread and a significant speedup when using multiple threads. -Machine generated data gets by far the biggest compression boost, with size being being reduced by up to 45% of Snappy size. +Machine generated data gets by far the biggest compression boost, with size being reduced by up to 35% of Snappy size. The "better" compression mode sees a good improvement in all cases, but usually at a performance cost. @@ -404,15 +405,15 @@ The "better" compression mode will actively look for shorter matches, which is w Without assembly decompression is also very fast; single goroutine decompression speed. No assembly: | File | S2 Throughput | S2 throughput | -|--------------------------------|--------------|---------------| -| consensus.db.10gb.s2 | 1.84x | 2289.8 MB/s | -| 10gb.tar.s2 | 1.30x | 867.07 MB/s | -| rawstudio-mint14.tar.s2 | 1.66x | 1329.65 MB/s | -| github-june-2days-2019.json.s2 | 2.36x | 1831.59 MB/s | -| github-ranks-backup.bin.s2 | 1.73x | 1390.7 MB/s | -| enwik9.s2 | 1.67x | 681.53 MB/s | -| adresser.json.s2 | 3.41x | 4230.53 MB/s | -| silesia.tar.s2 | 1.52x | 811.58 | +|--------------------------------|---------------|---------------| +| consensus.db.10gb.s2 | 1.84x | 2289.8 MB/s | +| 10gb.tar.s2 | 1.30x | 867.07 MB/s | +| rawstudio-mint14.tar.s2 | 1.66x | 1329.65 MB/s | +| github-june-2days-2019.json.s2 | 2.36x | 1831.59 MB/s | +| github-ranks-backup.bin.s2 | 1.73x | 1390.7 MB/s | +| enwik9.s2 | 1.67x | 681.53 MB/s | +| adresser.json.s2 | 3.41x | 4230.53 MB/s | +| silesia.tar.s2 | 1.52x | 811.58 | Even though S2 typically compresses better than Snappy, decompression speed is always better. @@ -450,14 +451,14 @@ The most reliable is a wide dataset. For this we use [`webdevdata.org-2015-01-07-subset`](https://files.klauspost.com/compress/webdevdata.org-2015-01-07-4GB-subset.7z), 53927 files, total input size: 4,014,735,833 bytes. Single goroutine used. -| * | Input | Output | Reduction | MB/s | -|-------------------|------------|------------|-----------|--------| -| S2 | 4014735833 | 1059723369 | 73.60% | **934.34** | -| S2 Better | 4014735833 | 969670507 | 75.85% | 532.70 | -| S2 Best | 4014735833 | 906625668 | **77.85%** | 46.84 | -| Snappy | 4014735833 | 1128706759 | 71.89% | 762.59 | -| S2, Snappy Output | 4014735833 | 1093821420 | 72.75% | 908.60 | -| LZ4 | 4014735833 | 1079259294 | 73.12% | 526.94 | +| * | Input | Output | Reduction | MB/s | +|-------------------|------------|------------|------------|------------| +| S2 | 4014735833 | 1059723369 | 73.60% | **936.73** | +| S2 Better | 4014735833 | 961580539 | 76.05% | 451.10 | +| S2 Best | 4014735833 | 899182886 | **77.60%** | 46.84 | +| Snappy | 4014735833 | 1128706759 | 71.89% | 790.15 | +| S2, Snappy Output | 4014735833 | 1093823291 | 72.75% | 936.60 | +| LZ4 | 4014735833 | 1063768713 | 73.50% | 452.02 | S2 delivers both the best single threaded throughput with regular mode and the best compression rate with "best". "Better" mode provides the same compression speed as LZ4 with better compression ratio. @@ -489,43 +490,24 @@ AMD64 assembly is use for both S2 and Snappy. | Absolute Perf | Snappy size | S2 Size | Snappy Speed | S2 Speed | Snappy dec | S2 dec | |-----------------------|-------------|---------|--------------|-------------|-------------|-------------| -| html | 22843 | 21111 | 16246 MB/s | 17438 MB/s | 40972 MB/s | 49263 MB/s | -| urls.10K | 335492 | 287326 | 7943 MB/s | 9693 MB/s | 22523 MB/s | 26484 MB/s | -| fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 273889 MB/s | 718321 MB/s | 827552 MB/s | -| fireworks.jpeg (200B) | 146 | 155 | 8869 MB/s | 17773 MB/s | 33691 MB/s | 52421 MB/s | -| paper-100k.pdf | 85304 | 84459 | 167546 MB/s | 101263 MB/s | 326905 MB/s | 291944 MB/s | -| html_x_4 | 92234 | 21113 | 15194 MB/s | 50670 MB/s | 30843 MB/s | 32217 MB/s | -| alice29.txt | 88034 | 85975 | 5936 MB/s | 6139 MB/s | 12882 MB/s | 20044 MB/s | -| asyoulik.txt | 77503 | 79650 | 5517 MB/s | 6366 MB/s | 12735 MB/s | 22806 MB/s | -| lcet10.txt | 234661 | 220670 | 6235 MB/s | 6067 MB/s | 14519 MB/s | 18697 MB/s | -| plrabn12.txt | 319267 | 317985 | 5159 MB/s | 5726 MB/s | 11923 MB/s | 19901 MB/s | -| geo.protodata | 23335 | 18690 | 21220 MB/s | 26529 MB/s | 56271 MB/s | 62540 MB/s | -| kppkn.gtb | 69526 | 65312 | 9732 MB/s | 8559 MB/s | 18491 MB/s | 18969 MB/s | -| alice29.txt (128B) | 80 | 82 | 6691 MB/s | 15489 MB/s | 31883 MB/s | 38874 MB/s | -| alice29.txt (1000B) | 774 | 774 | 12204 MB/s | 13000 MB/s | 48056 MB/s | 52341 MB/s | -| alice29.txt (10000B) | 6648 | 6933 | 10044 MB/s | 12806 MB/s | 32378 MB/s | 46322 MB/s | -| alice29.txt (20000B) | 12686 | 13574 | 7733 MB/s | 11210 MB/s | 30566 MB/s | 58969 MB/s | +| html | 22843 | 20868 | 16246 MB/s | 18617 MB/s | 40972 MB/s | 49263 MB/s | +| urls.10K | 335492 | 286541 | 7943 MB/s | 10201 MB/s | 22523 MB/s | 26484 MB/s | +| fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 303228 MB/s | 718321 MB/s | 827552 MB/s | +| fireworks.jpeg (200B) | 146 | 155 | 8869 MB/s | 20180 MB/s | 33691 MB/s | 52421 MB/s | +| paper-100k.pdf | 85304 | 84202 | 167546 MB/s | 112988 MB/s | 326905 MB/s | 291944 MB/s | +| html_x_4 | 92234 | 20870 | 15194 MB/s | 54457 MB/s | 30843 MB/s | 32217 MB/s | +| alice29.txt | 88034 | 85934 | 5936 MB/s | 6540 MB/s | 12882 MB/s | 20044 MB/s | +| asyoulik.txt | 77503 | 79575 | 5517 MB/s | 6657 MB/s | 12735 MB/s | 22806 MB/s | +| lcet10.txt | 234661 | 220383 | 6235 MB/s | 6303 MB/s | 14519 MB/s | 18697 MB/s | +| plrabn12.txt | 319267 | 318196 | 5159 MB/s | 6074 MB/s | 11923 MB/s | 19901 MB/s | +| geo.protodata | 23335 | 18606 | 21220 MB/s | 25432 MB/s | 56271 MB/s | 62540 MB/s | +| kppkn.gtb | 69526 | 65019 | 9732 MB/s | 8905 MB/s | 18491 MB/s | 18969 MB/s | +| alice29.txt (128B) | 80 | 82 | 6691 MB/s | 17179 MB/s | 31883 MB/s | 38874 MB/s | +| alice29.txt (1000B) | 774 | 774 | 12204 MB/s | 13273 MB/s | 48056 MB/s | 52341 MB/s | +| alice29.txt (10000B) | 6648 | 6933 | 10044 MB/s | 12824 MB/s | 32378 MB/s | 46322 MB/s | +| alice29.txt (20000B) | 12686 | 13516 | 7733 MB/s | 12160 MB/s | 30566 MB/s | 58969 MB/s | -| Relative Perf | Snappy size | S2 size improved | S2 Speed | S2 Dec Speed | -|-----------------------|-------------|------------------|----------|--------------| -| html | 22.31% | 7.58% | 1.07x | 1.20x | -| urls.10K | 47.78% | 14.36% | 1.22x | 1.18x | -| fireworks.jpeg | 99.95% | -0.05% | 0.78x | 1.15x | -| fireworks.jpeg (200B) | 73.00% | -6.16% | 2.00x | 1.56x | -| paper-100k.pdf | 83.30% | 0.99% | 0.60x | 0.89x | -| html_x_4 | 22.52% | 77.11% | 3.33x | 1.04x | -| alice29.txt | 57.88% | 2.34% | 1.03x | 1.56x | -| asyoulik.txt | 61.91% | -2.77% | 1.15x | 1.79x | -| lcet10.txt | 54.99% | 5.96% | 0.97x | 1.29x | -| plrabn12.txt | 66.26% | 0.40% | 1.11x | 1.67x | -| geo.protodata | 19.68% | 19.91% | 1.25x | 1.11x | -| kppkn.gtb | 37.72% | 6.06% | 0.88x | 1.03x | -| alice29.txt (128B) | 62.50% | -2.50% | 2.31x | 1.22x | -| alice29.txt (1000B) | 77.40% | 0.00% | 1.07x | 1.09x | -| alice29.txt (10000B) | 66.48% | -4.29% | 1.27x | 1.43x | -| alice29.txt (20000B) | 63.43% | -7.00% | 1.45x | 1.93x | - Speed is generally at or above Snappy. Small blocks gets a significant speedup, although at the expense of size. Decompression speed is better than Snappy, except in one case. @@ -543,43 +525,24 @@ So individual benchmarks should only be seen as a guideline and the overall pict | Absolute Perf | Snappy size | Better Size | Snappy Speed | Better Speed | Snappy dec | Better dec | |-----------------------|-------------|-------------|--------------|--------------|-------------|-------------| -| html | 22843 | 19833 | 16246 MB/s | 7731 MB/s | 40972 MB/s | 40292 MB/s | -| urls.10K | 335492 | 253529 | 7943 MB/s | 3980 MB/s | 22523 MB/s | 20981 MB/s | -| fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 9760 MB/s | 718321 MB/s | 823698 MB/s | -| fireworks.jpeg (200B) | 146 | 142 | 8869 MB/s | 594 MB/s | 33691 MB/s | 30101 MB/s | -| paper-100k.pdf | 85304 | 82915 | 167546 MB/s | 7470 MB/s | 326905 MB/s | 198869 MB/s | -| html_x_4 | 92234 | 19841 | 15194 MB/s | 23403 MB/s | 30843 MB/s | 30937 MB/s | -| alice29.txt | 88034 | 73218 | 5936 MB/s | 2945 MB/s | 12882 MB/s | 16611 MB/s | -| asyoulik.txt | 77503 | 66844 | 5517 MB/s | 2739 MB/s | 12735 MB/s | 14975 MB/s | -| lcet10.txt | 234661 | 190589 | 6235 MB/s | 3099 MB/s | 14519 MB/s | 16634 MB/s | -| plrabn12.txt | 319267 | 270828 | 5159 MB/s | 2600 MB/s | 11923 MB/s | 13382 MB/s | -| geo.protodata | 23335 | 18278 | 21220 MB/s | 11208 MB/s | 56271 MB/s | 57961 MB/s | -| kppkn.gtb | 69526 | 61851 | 9732 MB/s | 4556 MB/s | 18491 MB/s | 16524 MB/s | -| alice29.txt (128B) | 80 | 81 | 6691 MB/s | 529 MB/s | 31883 MB/s | 34225 MB/s | -| alice29.txt (1000B) | 774 | 748 | 12204 MB/s | 1943 MB/s | 48056 MB/s | 42068 MB/s | -| alice29.txt (10000B) | 6648 | 6234 | 10044 MB/s | 2949 MB/s | 32378 MB/s | 28813 MB/s | -| alice29.txt (20000B) | 12686 | 11584 | 7733 MB/s | 2822 MB/s | 30566 MB/s | 27315 MB/s | +| html | 22843 | 18972 | 16246 MB/s | 8621 MB/s | 40972 MB/s | 40292 MB/s | +| urls.10K | 335492 | 248079 | 7943 MB/s | 5104 MB/s | 22523 MB/s | 20981 MB/s | +| fireworks.jpeg | 123034 | 123100 | 349544 MB/s | 84429 MB/s | 718321 MB/s | 823698 MB/s | +| fireworks.jpeg (200B) | 146 | 149 | 8869 MB/s | 7125 MB/s | 33691 MB/s | 30101 MB/s | +| paper-100k.pdf | 85304 | 82887 | 167546 MB/s | 11087 MB/s | 326905 MB/s | 198869 MB/s | +| html_x_4 | 92234 | 18982 | 15194 MB/s | 29316 MB/s | 30843 MB/s | 30937 MB/s | +| alice29.txt | 88034 | 71611 | 5936 MB/s | 3709 MB/s | 12882 MB/s | 16611 MB/s | +| asyoulik.txt | 77503 | 65941 | 5517 MB/s | 3380 MB/s | 12735 MB/s | 14975 MB/s | +| lcet10.txt | 234661 | 184939 | 6235 MB/s | 3537 MB/s | 14519 MB/s | 16634 MB/s | +| plrabn12.txt | 319267 | 264990 | 5159 MB/s | 2960 MB/s | 11923 MB/s | 13382 MB/s | +| geo.protodata | 23335 | 17689 | 21220 MB/s | 10859 MB/s | 56271 MB/s | 57961 MB/s | +| kppkn.gtb | 69526 | 55398 | 9732 MB/s | 5206 MB/s | 18491 MB/s | 16524 MB/s | +| alice29.txt (128B) | 80 | 78 | 6691 MB/s | 7422 MB/s | 31883 MB/s | 34225 MB/s | +| alice29.txt (1000B) | 774 | 746 | 12204 MB/s | 5734 MB/s | 48056 MB/s | 42068 MB/s | +| alice29.txt (10000B) | 6648 | 6218 | 10044 MB/s | 6055 MB/s | 32378 MB/s | 28813 MB/s | +| alice29.txt (20000B) | 12686 | 11492 | 7733 MB/s | 3143 MB/s | 30566 MB/s | 27315 MB/s | -| Relative Perf | Snappy size | Better size | Better Speed | Better dec | -|-----------------------|-------------|-------------|--------------|------------| -| html | 22.31% | 13.18% | 0.48x | 0.98x | -| urls.10K | 47.78% | 24.43% | 0.50x | 0.93x | -| fireworks.jpeg | 99.95% | -0.05% | 0.03x | 1.15x | -| fireworks.jpeg (200B) | 73.00% | 2.74% | 0.07x | 0.89x | -| paper-100k.pdf | 83.30% | 2.80% | 0.07x | 0.61x | -| html_x_4 | 22.52% | 78.49% | 0.04x | 1.00x | -| alice29.txt | 57.88% | 16.83% | 1.54x | 1.29x | -| asyoulik.txt | 61.91% | 13.75% | 0.50x | 1.18x | -| lcet10.txt | 54.99% | 18.78% | 0.50x | 1.15x | -| plrabn12.txt | 66.26% | 15.17% | 0.50x | 1.12x | -| geo.protodata | 19.68% | 21.67% | 0.50x | 1.03x | -| kppkn.gtb | 37.72% | 11.04% | 0.53x | 0.89x | -| alice29.txt (128B) | 62.50% | -1.25% | 0.47x | 1.07x | -| alice29.txt (1000B) | 77.40% | 3.36% | 0.08x | 0.88x | -| alice29.txt (10000B) | 66.48% | 6.23% | 0.16x | 0.89x | -| alice29.txt (20000B) | 63.43% | 8.69% | 0.29x | 0.89x | - Except for the mostly incompressible JPEG image compression is better and usually in the double digits in terms of percentage reduction over Snappy. @@ -605,33 +568,150 @@ Some examples compared on 16 core CPU, amd64 assembly used: ``` * enwik10 -Default... 10000000000 -> 4761467548 [47.61%]; 1.098s, 8685.6MB/s -Better... 10000000000 -> 4219438251 [42.19%]; 1.925s, 4954.2MB/s -Best... 10000000000 -> 3627364337 [36.27%]; 43.051s, 221.5MB/s +Default... 10000000000 -> 4759950115 [47.60%]; 1.03s, 9263.0MB/s +Better... 10000000000 -> 4084706676 [40.85%]; 2.16s, 4415.4MB/s +Best... 10000000000 -> 3615520079 [36.16%]; 42.259s, 225.7MB/s * github-june-2days-2019.json -Default... 6273951764 -> 1043196283 [16.63%]; 431ms, 13882.3MB/s -Better... 6273951764 -> 949146808 [15.13%]; 547ms, 10938.4MB/s -Best... 6273951764 -> 832855506 [13.27%]; 9.455s, 632.8MB/s +Default... 6273951764 -> 1041700255 [16.60%]; 431ms, 13882.3MB/s +Better... 6273951764 -> 945841238 [15.08%]; 547ms, 10938.4MB/s +Best... 6273951764 -> 826392576 [13.17%]; 9.455s, 632.8MB/s * nyc-taxi-data-10M.csv -Default... 3325605752 -> 1095998837 [32.96%]; 324ms, 9788.7MB/s -Better... 3325605752 -> 954776589 [28.71%]; 491ms, 6459.4MB/s -Best... 3325605752 -> 779098746 [23.43%]; 8.29s, 382.6MB/s +Default... 3325605752 -> 1093516949 [32.88%]; 324ms, 9788.7MB/s +Better... 3325605752 -> 885394158 [26.62%]; 491ms, 6459.4MB/s +Best... 3325605752 -> 773681257 [23.26%]; 8.29s, 412.0MB/s * 10gb.tar -Default... 10065157632 -> 5916578242 [58.78%]; 1.028s, 9337.4MB/s -Better... 10065157632 -> 5649207485 [56.13%]; 1.597s, 6010.6MB/s -Best... 10065157632 -> 5208719802 [51.75%]; 32.78s, 292.8MB/ +Default... 10065157632 -> 5915541066 [58.77%]; 1.028s, 9337.4MB/s +Better... 10065157632 -> 5453844650 [54.19%]; 1.597s, 4862.7MB/s +Best... 10065157632 -> 5192495021 [51.59%]; 32.78s, 308.2MB/ * consensus.db.10gb -Default... 10737418240 -> 4562648848 [42.49%]; 882ms, 11610.0MB/s -Better... 10737418240 -> 4542428129 [42.30%]; 1.533s, 6679.7MB/s -Best... 10737418240 -> 4244773384 [39.53%]; 42.96s, 238.4MB/s +Default... 10737418240 -> 4549762344 [42.37%]; 882ms, 12118.4MB/s +Better... 10737418240 -> 4438535064 [41.34%]; 1.533s, 3500.9MB/s +Best... 10737418240 -> 4210602774 [39.21%]; 42.96s, 254.4MB/s ``` Decompression speed should be around the same as using the 'better' compression mode. +## Dictionaries + +*Note: S2 dictionary compression is currently at an early implementation stage, with no assembly for +neither encoding nor decoding. Performance improvements can be expected in the future.* + +Adding dictionaries allow providing a custom dictionary that will serve as lookup in the beginning of blocks. + +The same dictionary *must* be used for both encoding and decoding. +S2 does not keep track of whether the same dictionary is used, +and using the wrong dictionary will most often not result in an error when decompressing. + +Blocks encoded *without* dictionaries can be decompressed seamlessly *with* a dictionary. +This means it is possible to switch from an encoding without dictionaries to an encoding with dictionaries +and treat the blocks similarly. + +Similar to [zStandard dictionaries](https://github.com/facebook/zstd#the-case-for-small-data-compression), +the same usage scenario applies to S2 dictionaries. + +> Training works if there is some correlation in a family of small data samples. The more data-specific a dictionary is, the more efficient it is (there is no universal dictionary). Hence, deploying one dictionary per type of data will provide the greatest benefits. Dictionary gains are mostly effective in the first few KB. Then, the compression algorithm will gradually use previously decoded content to better compress the rest of the file. + +S2 further limits the dictionary to only be enabled on the first 64KB of a block. +This will remove any negative (speed) impacts of the dictionaries on bigger blocks. + +### Compression + +Using the [github_users_sample_set](https://github.com/facebook/zstd/releases/download/v1.1.3/github_users_sample_set.tar.zst) +and a 64KB dictionary trained with zStandard the following sizes can be achieved. + +| | Default | Better | Best | +|--------------------|------------------|------------------|-----------------------| +| Without Dictionary | 3362023 (44.92%) | 3083163 (41.19%) | 3057944 (40.86%) | +| With Dictionary | 921524 (12.31%) | 873154 (11.67%) | 785503 bytes (10.49%) | + +So for highly repetitive content, this case provides an almost 3x reduction in size. + +For less uniform data we will use the Go source code tree. +Compressing First 64KB of all `.go` files in `go/src`, Go 1.19.5, 8912 files, 51253563 bytes input: + +| | Default | Better | Best | +|--------------------|-------------------|-------------------|-------------------| +| Without Dictionary | 22955767 (44.79%) | 20189613 (39.39% | 19482828 (38.01%) | +| With Dictionary | 19654568 (38.35%) | 16289357 (31.78%) | 15184589 (29.63%) | +| Saving/file | 362 bytes | 428 bytes | 472 bytes | + + +### Creating Dictionaries + +There are no tools to create dictionaries in S2. +However, there are multiple ways to create a useful dictionary: + +#### Using a Sample File + +If your input is very uniform, you can just use a sample file as the dictionary. + +For example in the `github_users_sample_set` above, the average compression only goes up from +10.49% to 11.48% by using the first file as dictionary compared to using a dedicated dictionary. + +```Go + // Read a sample + sample, err := os.ReadFile("sample.json") + + // Create a dictionary. + dict := s2.MakeDict(sample, nil) + + // b := dict.Bytes() will provide a dictionary that can be saved + // and reloaded with s2.NewDict(b). + + // To encode: + encoded := dict.Encode(nil, file) + + // To decode: + decoded, err := dict.Decode(nil, file) +``` + +#### Using Zstandard + +Zstandard dictionaries can easily be converted to S2 dictionaries. + +This can be helpful to generate dictionaries for files that don't have a fixed structure. + + +Example, with training set files placed in `./training-set`: + +`λ zstd -r --train-fastcover training-set/* --maxdict=65536 -o name.dict` + +This will create a dictionary of 64KB, that can be converted to a dictionary like this: + +```Go + // Decode the Zstandard dictionary. + insp, err := zstd.InspectDictionary(zdict) + if err != nil { + panic(err) + } + + // We are only interested in the contents. + // Assume that files start with "// Copyright (c) 2023". + // Search for the longest match for that. + // This may save a few bytes. + dict := s2.MakeDict(insp.Content(), []byte("// Copyright (c) 2023")) + + // b := dict.Bytes() will provide a dictionary that can be saved + // and reloaded with s2.NewDict(b). + + // We can now encode using this dictionary + encodedWithDict := dict.Encode(nil, payload) + + // To decode content: + decoded, err := dict.Decode(nil, encodedWithDict) +``` + +It is recommended to save the dictionary returned by ` b:= dict.Bytes()`, since that will contain only the S2 dictionary. + +This dictionary can later be loaded using `s2.NewDict(b)`. The dictionary then no longer requires `zstd` to be initialized. + +Also note how `s2.MakeDict` allows you to search for a common starting sequence of your files. +This can be omitted, at the expense of a few bytes. + # Snappy Compatibility S2 now offers full compatibility with Snappy. @@ -648,10 +728,10 @@ If you would like more control, you can use the s2 package as described below: Snappy compatible blocks can be generated with the S2 encoder. Compression and speed is typically a bit better `MaxEncodedLen` is also smaller for smaller memory usage. Replace -| Snappy | S2 replacement | -|----------------------------|-------------------------| -| snappy.Encode(...) | s2.EncodeSnappy(...) | -| snappy.MaxEncodedLen(...) | s2.MaxEncodedLen(...) | +| Snappy | S2 replacement | +|---------------------------|-----------------------| +| snappy.Encode(...) | s2.EncodeSnappy(...) | +| snappy.MaxEncodedLen(...) | s2.MaxEncodedLen(...) | `s2.EncodeSnappy` can be replaced with `s2.EncodeSnappyBetter` or `s2.EncodeSnappyBest` to get more efficiently compressed snappy compatible output. @@ -660,12 +740,12 @@ Compression and speed is typically a bit better `MaxEncodedLen` is also smaller Comparison of [`webdevdata.org-2015-01-07-subset`](https://files.klauspost.com/compress/webdevdata.org-2015-01-07-4GB-subset.7z), 53927 files, total input size: 4,014,735,833 bytes. amd64, single goroutine used: -| Encoder | Size | MB/s | Reduction | -|-----------------------|------------|------------|------------ -| snappy.Encode | 1128706759 | 725.59 | 71.89% | -| s2.EncodeSnappy | 1093823291 | **899.16** | 72.75% | -| s2.EncodeSnappyBetter | 1001158548 | 578.49 | 75.06% | -| s2.EncodeSnappyBest | 944507998 | 66.00 | **76.47%**| +| Encoder | Size | MB/s | Reduction | +|-----------------------|------------|------------|------------| +| snappy.Encode | 1128706759 | 725.59 | 71.89% | +| s2.EncodeSnappy | 1093823291 | **899.16** | 72.75% | +| s2.EncodeSnappyBetter | 1001158548 | 578.49 | 75.06% | +| s2.EncodeSnappyBest | 944507998 | 66.00 | **76.47%** | ## Streams @@ -835,6 +915,13 @@ This is done using the regular "Skip" function: This will ensure that we are at exactly the offset we want, and reading from `dec` will start at the requested offset. +# Compact storage + +For compact storage [RemoveIndexHeaders](https://pkg.go.dev/github.com/klauspost/compress/s2#RemoveIndexHeaders) can be used to remove any redundant info from +a serialized index. If you remove the header it must be restored before [Loading](https://pkg.go.dev/github.com/klauspost/compress/s2#Index.Load). + +This is expected to save 20 bytes. These can be restored using [RestoreIndexHeaders](https://pkg.go.dev/github.com/klauspost/compress/s2#RestoreIndexHeaders). This removes a layer of security, but is the most compact representation. Returns nil if headers contains errors. + ## Index Format: Each block is structured as a snappy skippable block, with the chunk ID 0x99. @@ -844,20 +931,20 @@ The block can be read from the front, but contains information so it can be read Numbers are stored as fixed size little endian values or [zigzag encoded](https://developers.google.com/protocol-buffers/docs/encoding#signed_integers) [base 128 varints](https://developers.google.com/protocol-buffers/docs/encoding), with un-encoded value length of 64 bits, unless other limits are specified. -| Content | Format | -|---------------------------------------------------------------------------|-----------------------------------------------------------------------------------------------------------------------------| -| ID, `[1]byte` | Always 0x99. | -| Data Length, `[3]byte` | 3 byte little-endian length of the chunk in bytes, following this. | -| Header `[6]byte` | Header, must be `[115, 50, 105, 100, 120, 0]` or in text: "s2idx\x00". | -| UncompressedSize, Varint | Total Uncompressed size. | -| CompressedSize, Varint | Total Compressed size if known. Should be -1 if unknown. | -| EstBlockSize, Varint | Block Size, used for guessing uncompressed offsets. Must be >= 0. | -| Entries, Varint | Number of Entries in index, must be < 65536 and >=0. | -| HasUncompressedOffsets `byte` | 0 if no uncompressed offsets are present, 1 if present. Other values are invalid. | -| UncompressedOffsets, [Entries]VarInt | Uncompressed offsets. See below how to decode. | -| CompressedOffsets, [Entries]VarInt | Compressed offsets. See below how to decode. | -| Block Size, `[4]byte` | Little Endian total encoded size (including header and trailer). Can be used for searching backwards to start of block. | -| Trailer `[6]byte` | Trailer, must be `[0, 120, 100, 105, 50, 115]` or in text: "\x00xdi2s". Can be used for identifying block from end of stream. | +| Content | Format | +|--------------------------------------|-------------------------------------------------------------------------------------------------------------------------------| +| ID, `[1]byte` | Always 0x99. | +| Data Length, `[3]byte` | 3 byte little-endian length of the chunk in bytes, following this. | +| Header `[6]byte` | Header, must be `[115, 50, 105, 100, 120, 0]` or in text: "s2idx\x00". | +| UncompressedSize, Varint | Total Uncompressed size. | +| CompressedSize, Varint | Total Compressed size if known. Should be -1 if unknown. | +| EstBlockSize, Varint | Block Size, used for guessing uncompressed offsets. Must be >= 0. | +| Entries, Varint | Number of Entries in index, must be < 65536 and >=0. | +| HasUncompressedOffsets `byte` | 0 if no uncompressed offsets are present, 1 if present. Other values are invalid. | +| UncompressedOffsets, [Entries]VarInt | Uncompressed offsets. See below how to decode. | +| CompressedOffsets, [Entries]VarInt | Compressed offsets. See below how to decode. | +| Block Size, `[4]byte` | Little Endian total encoded size (including header and trailer). Can be used for searching backwards to start of block. | +| Trailer `[6]byte` | Trailer, must be `[0, 120, 100, 105, 50, 115]` or in text: "\x00xdi2s". Can be used for identifying block from end of stream. | For regular streams the uncompressed offsets are fully predictable, so `HasUncompressedOffsets` allows to specify that compressed blocks all have @@ -929,6 +1016,7 @@ To decode from any given uncompressed offset `(wantOffset)`: See [using indexes](https://github.com/klauspost/compress/tree/master/s2#using-indexes) for functions that perform the operations with a simpler interface. + # Format Extensions * Frame [Stream identifier](https://github.com/google/snappy/blob/master/framing_format.txt#L68) changed from `sNaPpY` to `S2sTwO`. @@ -951,13 +1039,80 @@ The length is specified by reading the 3-bit length specified in the tag and dec | 7 | 65540 + read 3 bytes | This allows any repeat offset + length to be represented by 2 to 5 bytes. +It also allows to emit matches longer than 64 bytes with one copy + one repeat instead of several 64 byte copies. Lengths are stored as little endian values. -The first copy of a block cannot be a repeat offset and the offset is not carried across blocks in streams. +The first copy of a block cannot be a repeat offset and the offset is reset on every block in streams. Default streaming block size is 1MB. +# Dictionary Encoding + +Adding dictionaries allow providing a custom dictionary that will serve as lookup in the beginning of blocks. + +A dictionary provides an initial repeat value that can be used to point to a common header. + +Other than that the dictionary contains values that can be used as back-references. + +Often used data should be placed at the *end* of the dictionary since offsets < 2048 bytes will be smaller. + +## Format + +Dictionary *content* must at least 16 bytes and less or equal to 64KiB (65536 bytes). + +Encoding: `[repeat value (uvarint)][dictionary content...]` + +Before the dictionary content, an unsigned base-128 (uvarint) encoded value specifying the initial repeat offset. +This value is an offset into the dictionary content and not a back-reference offset, +so setting this to 0 will make the repeat value point to the first value of the dictionary. + +The value must be less than the dictionary length-8 + +## Encoding + +From the decoder point of view the dictionary content is seen as preceding the encoded content. + +`[dictionary content][decoded output]` + +Backreferences to the dictionary are encoded as ordinary backreferences that have an offset before the start of the decoded block. + +Matches copying from the dictionary are **not** allowed to cross from the dictionary into the decoded data. +However, if a copy ends at the end of the dictionary the next repeat will point to the start of the decoded buffer, which is allowed. + +The first match can be a repeat value, which will use the repeat offset stored in the dictionary. + +When 64KB (65536 bytes) has been en/decoded it is no longer allowed to reference the dictionary, +neither by a copy nor repeat operations. +If the boundary is crossed while copying from the dictionary, the operation should complete, +but the next instruction is not allowed to reference the dictionary. + +Valid blocks encoded *without* a dictionary can be decoded with any dictionary. +There are no checks whether the supplied dictionary is the correct for a block. +Because of this there is no overhead by using a dictionary. + +## Example + +This is the dictionary content. Elements are separated by `[]`. + +Dictionary: `[0x0a][Yesterday 25 bananas were added to Benjamins brown bag]`. + +Initial repeat offset is set at 10, which is the letter `2`. + +Encoded `[LIT "10"][REPEAT len=10][LIT "hich"][MATCH off=50 len=6][MATCH off=31 len=6][MATCH off=61 len=10]` + +Decoded: `[10][ bananas w][hich][ were ][brown ][were added]` + +Output: `10 bananas which were brown were added` + + +## Streams + +For streams each block can use the dictionary. + +The dictionary cannot not currently be provided on the stream. + + # LICENSE This code is based on the [Snappy-Go](https://github.com/golang/snappy) implementation. diff --git a/vendor/github.com/klauspost/compress/s2/decode.go b/vendor/github.com/klauspost/compress/s2/decode.go index b5fa4d3f..b7c9adfd 100644 --- a/vendor/github.com/klauspost/compress/s2/decode.go +++ b/vendor/github.com/klauspost/compress/s2/decode.go @@ -11,7 +11,9 @@ import ( "fmt" "io" "io/ioutil" + "math" "runtime" + "strconv" "sync" ) @@ -719,7 +721,11 @@ func (r *Reader) Skip(n int64) error { // decoded[i:j] contains decoded bytes that have not yet been passed on. left := int64(r.j - r.i) if left >= n { - r.i += int(n) + tmp := int64(r.i) + n + if tmp > math.MaxInt32 { + return errors.New("s2: internal overflow in skip") + } + r.i = int(tmp) return nil } n -= int64(r.j - r.i) @@ -875,15 +881,20 @@ func (r *Reader) Skip(n int64) error { // See Reader.ReadSeeker type ReadSeeker struct { *Reader + readAtMu sync.Mutex } -// ReadSeeker will return an io.ReadSeeker compatible version of the reader. +// ReadSeeker will return an io.ReadSeeker and io.ReaderAt +// compatible version of the reader. // If 'random' is specified the returned io.Seeker can be used for // random seeking, otherwise only forward seeking is supported. // Enabling random seeking requires the original input to support // the io.Seeker interface. // A custom index can be specified which will be used if supplied. // When using a custom index, it will not be read from the input stream. +// The ReadAt position will affect regular reads and the current position of Seek. +// So using Read after ReadAt will continue from where the ReadAt stopped. +// No functions should be used concurrently. // The returned ReadSeeker contains a shallow reference to the existing Reader, // meaning changes performed to one is reflected in the other. func (r *Reader) ReadSeeker(random bool, index []byte) (*ReadSeeker, error) { @@ -947,44 +958,61 @@ func (r *Reader) ReadSeeker(random bool, index []byte) (*ReadSeeker, error) { // Seek allows seeking in compressed data. func (r *ReadSeeker) Seek(offset int64, whence int) (int64, error) { if r.err != nil { - return 0, r.err - } - if offset == 0 && whence == io.SeekCurrent { - return r.blockStart + int64(r.i), nil - } - if !r.readHeader { - // Make sure we read the header. - _, r.err = r.Read([]byte{}) - } - rs, ok := r.r.(io.ReadSeeker) - if r.index == nil || !ok { - if whence == io.SeekCurrent && offset >= 0 { - err := r.Skip(offset) - return r.blockStart + int64(r.i), err + if !errors.Is(r.err, io.EOF) { + return 0, r.err } - if whence == io.SeekStart && offset >= r.blockStart+int64(r.i) { - err := r.Skip(offset - r.blockStart - int64(r.i)) - return r.blockStart + int64(r.i), err - } - return 0, ErrUnsupported + // Reset on EOF + r.err = nil + } - } + // Calculate absolute offset. + absOffset := offset switch whence { + case io.SeekStart: case io.SeekCurrent: - offset += r.blockStart + int64(r.i) + absOffset = r.blockStart + int64(r.i) + offset case io.SeekEnd: - if offset > 0 { - return 0, errors.New("seek after end of file") + if r.index == nil { + return 0, ErrUnsupported } - offset = r.index.TotalUncompressed + offset + absOffset = r.index.TotalUncompressed + offset + default: + r.err = ErrUnsupported + return 0, r.err } - if offset < 0 { + if absOffset < 0 { return 0, errors.New("seek before start of file") } - c, u, err := r.index.Find(offset) + if !r.readHeader { + // Make sure we read the header. + _, r.err = r.Read([]byte{}) + if r.err != nil { + return 0, r.err + } + } + + // If we are inside current block no need to seek. + // This includes no offset changes. + if absOffset >= r.blockStart && absOffset < r.blockStart+int64(r.j) { + r.i = int(absOffset - r.blockStart) + return r.blockStart + int64(r.i), nil + } + + rs, ok := r.r.(io.ReadSeeker) + if r.index == nil || !ok { + currOffset := r.blockStart + int64(r.i) + if absOffset >= currOffset { + err := r.Skip(absOffset - currOffset) + return r.blockStart + int64(r.i), err + } + return 0, ErrUnsupported + } + + // We can seek and we have an index. + c, u, err := r.index.Find(absOffset) if err != nil { return r.blockStart + int64(r.i), err } @@ -995,12 +1023,57 @@ func (r *ReadSeeker) Seek(offset int64, whence int) (int64, error) { return 0, err } - r.i = r.j // Remove rest of current block. - if u < offset { + r.i = r.j // Remove rest of current block. + r.blockStart = u - int64(r.j) // Adjust current block start for accounting. + if u < absOffset { // Forward inside block - return offset, r.Skip(offset - u) + return absOffset, r.Skip(absOffset - u) } - return offset, nil + if u > absOffset { + return 0, fmt.Errorf("s2 seek: (internal error) u (%d) > absOffset (%d)", u, absOffset) + } + return absOffset, nil +} + +// ReadAt reads len(p) bytes into p starting at offset off in the +// underlying input source. It returns the number of bytes +// read (0 <= n <= len(p)) and any error encountered. +// +// When ReadAt returns n < len(p), it returns a non-nil error +// explaining why more bytes were not returned. In this respect, +// ReadAt is stricter than Read. +// +// Even if ReadAt returns n < len(p), it may use all of p as scratch +// space during the call. If some data is available but not len(p) bytes, +// ReadAt blocks until either all the data is available or an error occurs. +// In this respect ReadAt is different from Read. +// +// If the n = len(p) bytes returned by ReadAt are at the end of the +// input source, ReadAt may return either err == EOF or err == nil. +// +// If ReadAt is reading from an input source with a seek offset, +// ReadAt should not affect nor be affected by the underlying +// seek offset. +// +// Clients of ReadAt can execute parallel ReadAt calls on the +// same input source. This is however not recommended. +func (r *ReadSeeker) ReadAt(p []byte, offset int64) (int, error) { + r.readAtMu.Lock() + defer r.readAtMu.Unlock() + _, err := r.Seek(offset, io.SeekStart) + if err != nil { + return 0, err + } + n := 0 + for n < len(p) { + n2, err := r.Read(p[n:]) + if err != nil { + // This will include io.EOF + return n + n2, err + } + n += n2 + } + return n, nil } // ReadByte satisfies the io.ByteReader interface. @@ -1039,3 +1112,370 @@ func (r *Reader) SkippableCB(id uint8, fn func(r io.Reader) error) error { r.skippableCB[id] = fn return nil } + +// s2DecodeDict writes the decoding of src to dst. It assumes that the varint-encoded +// length of the decompressed bytes has already been read, and that len(dst) +// equals that length. +// +// It returns 0 on success or a decodeErrCodeXxx error code on failure. +func s2DecodeDict(dst, src []byte, dict *Dict) int { + if dict == nil { + return s2Decode(dst, src) + } + const debug = false + const debugErrs = debug + + if debug { + fmt.Println("Starting decode, dst len:", len(dst)) + } + var d, s, length int + offset := len(dict.dict) - dict.repeat + + // As long as we can read at least 5 bytes... + for s < len(src)-5 { + // Removing bounds checks is SLOWER, when if doing + // in := src[s:s+5] + // Checked on Go 1.18 + switch src[s] & 0x03 { + case tagLiteral: + x := uint32(src[s] >> 2) + switch { + case x < 60: + s++ + case x == 60: + s += 2 + x = uint32(src[s-1]) + case x == 61: + in := src[s : s+3] + x = uint32(in[1]) | uint32(in[2])<<8 + s += 3 + case x == 62: + in := src[s : s+4] + // Load as 32 bit and shift down. + x = uint32(in[0]) | uint32(in[1])<<8 | uint32(in[2])<<16 | uint32(in[3])<<24 + x >>= 8 + s += 4 + case x == 63: + in := src[s : s+5] + x = uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24 + s += 5 + } + length = int(x) + 1 + if debug { + fmt.Println("literals, length:", length, "d-after:", d+length) + } + if length > len(dst)-d || length > len(src)-s || (strconv.IntSize == 32 && length <= 0) { + if debugErrs { + fmt.Println("corrupt literal: length:", length, "d-left:", len(dst)-d, "src-left:", len(src)-s) + } + return decodeErrCodeCorrupt + } + + copy(dst[d:], src[s:s+length]) + d += length + s += length + continue + + case tagCopy1: + s += 2 + toffset := int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1])) + length = int(src[s-2]) >> 2 & 0x7 + if toffset == 0 { + if debug { + fmt.Print("(repeat) ") + } + // keep last offset + switch length { + case 5: + length = int(src[s]) + 4 + s += 1 + case 6: + in := src[s : s+2] + length = int(uint32(in[0])|(uint32(in[1])<<8)) + (1 << 8) + s += 2 + case 7: + in := src[s : s+3] + length = int((uint32(in[2])<<16)|(uint32(in[1])<<8)|uint32(in[0])) + (1 << 16) + s += 3 + default: // 0-> 4 + } + } else { + offset = toffset + } + length += 4 + case tagCopy2: + in := src[s : s+3] + offset = int(uint32(in[1]) | uint32(in[2])<<8) + length = 1 + int(in[0])>>2 + s += 3 + + case tagCopy4: + in := src[s : s+5] + offset = int(uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24) + length = 1 + int(in[0])>>2 + s += 5 + } + + if offset <= 0 || length > len(dst)-d { + if debugErrs { + fmt.Println("match error; offset:", offset, "length:", length, "dst-left:", len(dst)-d) + } + return decodeErrCodeCorrupt + } + + // copy from dict + if d < offset { + if d > MaxDictSrcOffset { + if debugErrs { + fmt.Println("dict after", MaxDictSrcOffset, "d:", d, "offset:", offset, "length:", length) + } + return decodeErrCodeCorrupt + } + startOff := len(dict.dict) - offset + d + if startOff < 0 || startOff+length > len(dict.dict) { + if debugErrs { + fmt.Printf("offset (%d) + length (%d) bigger than dict (%d)\n", offset, length, len(dict.dict)) + } + return decodeErrCodeCorrupt + } + if debug { + fmt.Println("dict copy, length:", length, "offset:", offset, "d-after:", d+length, "dict start offset:", startOff) + } + copy(dst[d:d+length], dict.dict[startOff:]) + d += length + continue + } + + if debug { + fmt.Println("copy, length:", length, "offset:", offset, "d-after:", d+length) + } + + // Copy from an earlier sub-slice of dst to a later sub-slice. + // If no overlap, use the built-in copy: + if offset > length { + copy(dst[d:d+length], dst[d-offset:]) + d += length + continue + } + + // Unlike the built-in copy function, this byte-by-byte copy always runs + // forwards, even if the slices overlap. Conceptually, this is: + // + // d += forwardCopy(dst[d:d+length], dst[d-offset:]) + // + // We align the slices into a and b and show the compiler they are the same size. + // This allows the loop to run without bounds checks. + a := dst[d : d+length] + b := dst[d-offset:] + b = b[:len(a)] + for i := range a { + a[i] = b[i] + } + d += length + } + + // Remaining with extra checks... + for s < len(src) { + switch src[s] & 0x03 { + case tagLiteral: + x := uint32(src[s] >> 2) + switch { + case x < 60: + s++ + case x == 60: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + x = uint32(src[s-1]) + case x == 61: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + x = uint32(src[s-2]) | uint32(src[s-1])<<8 + case x == 62: + s += 4 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + x = uint32(src[s-3]) | uint32(src[s-2])<<8 | uint32(src[s-1])<<16 + case x == 63: + s += 5 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + x = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24 + } + length = int(x) + 1 + if length > len(dst)-d || length > len(src)-s || (strconv.IntSize == 32 && length <= 0) { + if debugErrs { + fmt.Println("corrupt literal: length:", length, "d-left:", len(dst)-d, "src-left:", len(src)-s) + } + return decodeErrCodeCorrupt + } + if debug { + fmt.Println("literals, length:", length, "d-after:", d+length) + } + + copy(dst[d:], src[s:s+length]) + d += length + s += length + continue + + case tagCopy1: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + length = int(src[s-2]) >> 2 & 0x7 + toffset := int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1])) + if toffset == 0 { + if debug { + fmt.Print("(repeat) ") + } + // keep last offset + switch length { + case 5: + s += 1 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + length = int(uint32(src[s-1])) + 4 + case 6: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + length = int(uint32(src[s-2])|(uint32(src[s-1])<<8)) + (1 << 8) + case 7: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + length = int(uint32(src[s-3])|(uint32(src[s-2])<<8)|(uint32(src[s-1])<<16)) + (1 << 16) + default: // 0-> 4 + } + } else { + offset = toffset + } + length += 4 + case tagCopy2: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + length = 1 + int(src[s-3])>>2 + offset = int(uint32(src[s-2]) | uint32(src[s-1])<<8) + + case tagCopy4: + s += 5 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + if debugErrs { + fmt.Println("src went oob") + } + return decodeErrCodeCorrupt + } + length = 1 + int(src[s-5])>>2 + offset = int(uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24) + } + + if offset <= 0 || length > len(dst)-d { + if debugErrs { + fmt.Println("match error; offset:", offset, "length:", length, "dst-left:", len(dst)-d) + } + return decodeErrCodeCorrupt + } + + // copy from dict + if d < offset { + if d > MaxDictSrcOffset { + if debugErrs { + fmt.Println("dict after", MaxDictSrcOffset, "d:", d, "offset:", offset, "length:", length) + } + return decodeErrCodeCorrupt + } + rOff := len(dict.dict) - (offset - d) + if debug { + fmt.Println("starting dict entry from dict offset", len(dict.dict)-rOff) + } + if rOff+length > len(dict.dict) { + if debugErrs { + fmt.Println("err: END offset", rOff+length, "bigger than dict", len(dict.dict), "dict offset:", rOff, "length:", length) + } + return decodeErrCodeCorrupt + } + if rOff < 0 { + if debugErrs { + fmt.Println("err: START offset", rOff, "less than 0", len(dict.dict), "dict offset:", rOff, "length:", length) + } + return decodeErrCodeCorrupt + } + copy(dst[d:d+length], dict.dict[rOff:]) + d += length + continue + } + + if debug { + fmt.Println("copy, length:", length, "offset:", offset, "d-after:", d+length) + } + + // Copy from an earlier sub-slice of dst to a later sub-slice. + // If no overlap, use the built-in copy: + if offset > length { + copy(dst[d:d+length], dst[d-offset:]) + d += length + continue + } + + // Unlike the built-in copy function, this byte-by-byte copy always runs + // forwards, even if the slices overlap. Conceptually, this is: + // + // d += forwardCopy(dst[d:d+length], dst[d-offset:]) + // + // We align the slices into a and b and show the compiler they are the same size. + // This allows the loop to run without bounds checks. + a := dst[d : d+length] + b := dst[d-offset:] + b = b[:len(a)] + for i := range a { + a[i] = b[i] + } + d += length + } + + if d != len(dst) { + if debugErrs { + fmt.Println("wanted length", len(dst), "got", d) + } + return decodeErrCodeCorrupt + } + return 0 +} diff --git a/vendor/github.com/klauspost/compress/s2/decode_other.go b/vendor/github.com/klauspost/compress/s2/decode_other.go index 1074ebd2..2cb55c2c 100644 --- a/vendor/github.com/klauspost/compress/s2/decode_other.go +++ b/vendor/github.com/klauspost/compress/s2/decode_other.go @@ -28,6 +28,9 @@ func s2Decode(dst, src []byte) int { // As long as we can read at least 5 bytes... for s < len(src)-5 { + // Removing bounds checks is SLOWER, when if doing + // in := src[s:s+5] + // Checked on Go 1.18 switch src[s] & 0x03 { case tagLiteral: x := uint32(src[s] >> 2) @@ -38,17 +41,25 @@ func s2Decode(dst, src []byte) int { s += 2 x = uint32(src[s-1]) case x == 61: + in := src[s : s+3] + x = uint32(in[1]) | uint32(in[2])<<8 s += 3 - x = uint32(src[s-2]) | uint32(src[s-1])<<8 case x == 62: + in := src[s : s+4] + // Load as 32 bit and shift down. + x = uint32(in[0]) | uint32(in[1])<<8 | uint32(in[2])<<16 | uint32(in[3])<<24 + x >>= 8 s += 4 - x = uint32(src[s-3]) | uint32(src[s-2])<<8 | uint32(src[s-1])<<16 case x == 63: + in := src[s : s+5] + x = uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24 s += 5 - x = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24 } length = int(x) + 1 if length > len(dst)-d || length > len(src)-s || (strconv.IntSize == 32 && length <= 0) { + if debug { + fmt.Println("corrupt: lit size", length) + } return decodeErrCodeCorrupt } if debug { @@ -62,8 +73,8 @@ func s2Decode(dst, src []byte) int { case tagCopy1: s += 2 - length = int(src[s-2]) >> 2 & 0x7 toffset := int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1])) + length = int(src[s-2]) >> 2 & 0x7 if toffset == 0 { if debug { fmt.Print("(repeat) ") @@ -71,14 +82,16 @@ func s2Decode(dst, src []byte) int { // keep last offset switch length { case 5: + length = int(src[s]) + 4 s += 1 - length = int(uint32(src[s-1])) + 4 case 6: + in := src[s : s+2] + length = int(uint32(in[0])|(uint32(in[1])<<8)) + (1 << 8) s += 2 - length = int(uint32(src[s-2])|(uint32(src[s-1])<<8)) + (1 << 8) case 7: + in := src[s : s+3] + length = int((uint32(in[2])<<16)|(uint32(in[1])<<8)|uint32(in[0])) + (1 << 16) s += 3 - length = int(uint32(src[s-3])|(uint32(src[s-2])<<8)|(uint32(src[s-1])<<16)) + (1 << 16) default: // 0-> 4 } } else { @@ -86,17 +99,23 @@ func s2Decode(dst, src []byte) int { } length += 4 case tagCopy2: + in := src[s : s+3] + offset = int(uint32(in[1]) | uint32(in[2])<<8) + length = 1 + int(in[0])>>2 s += 3 - length = 1 + int(src[s-3])>>2 - offset = int(uint32(src[s-2]) | uint32(src[s-1])<<8) case tagCopy4: + in := src[s : s+5] + offset = int(uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24) + length = 1 + int(in[0])>>2 s += 5 - length = 1 + int(src[s-5])>>2 - offset = int(uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24) } if offset <= 0 || d < offset || length > len(dst)-d { + if debug { + fmt.Println("corrupt: match, length", length, "offset:", offset, "dst avail:", len(dst)-d, "dst pos:", d) + } + return decodeErrCodeCorrupt } @@ -163,6 +182,9 @@ func s2Decode(dst, src []byte) int { } length = int(x) + 1 if length > len(dst)-d || length > len(src)-s || (strconv.IntSize == 32 && length <= 0) { + if debug { + fmt.Println("corrupt: lit size", length) + } return decodeErrCodeCorrupt } if debug { @@ -229,6 +251,9 @@ func s2Decode(dst, src []byte) int { } if offset <= 0 || d < offset || length > len(dst)-d { + if debug { + fmt.Println("corrupt: match, length", length, "offset:", offset, "dst avail:", len(dst)-d, "dst pos:", d) + } return decodeErrCodeCorrupt } diff --git a/vendor/github.com/klauspost/compress/s2/dict.go b/vendor/github.com/klauspost/compress/s2/dict.go new file mode 100644 index 00000000..24f7ce80 --- /dev/null +++ b/vendor/github.com/klauspost/compress/s2/dict.go @@ -0,0 +1,331 @@ +// Copyright (c) 2022+ Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package s2 + +import ( + "bytes" + "encoding/binary" + "sync" +) + +const ( + // MinDictSize is the minimum dictionary size when repeat has been read. + MinDictSize = 16 + + // MaxDictSize is the maximum dictionary size when repeat has been read. + MaxDictSize = 65536 + + // MaxDictSrcOffset is the maximum offset where a dictionary entry can start. + MaxDictSrcOffset = 65535 +) + +// Dict contains a dictionary that can be used for encoding and decoding s2 +type Dict struct { + dict []byte + repeat int // Repeat as index of dict + + fast, better, best sync.Once + fastTable *[1 << 14]uint16 + + betterTableShort *[1 << 14]uint16 + betterTableLong *[1 << 17]uint16 + + bestTableShort *[1 << 16]uint32 + bestTableLong *[1 << 19]uint32 +} + +// NewDict will read a dictionary. +// It will return nil if the dictionary is invalid. +func NewDict(dict []byte) *Dict { + if len(dict) == 0 { + return nil + } + var d Dict + // Repeat is the first value of the dict + r, n := binary.Uvarint(dict) + if n <= 0 { + return nil + } + dict = dict[n:] + d.dict = dict + if cap(d.dict) < len(d.dict)+16 { + d.dict = append(make([]byte, 0, len(d.dict)+16), d.dict...) + } + if len(dict) < MinDictSize || len(dict) > MaxDictSize { + return nil + } + d.repeat = int(r) + if d.repeat > len(dict) { + return nil + } + return &d +} + +// Bytes will return a serialized version of the dictionary. +// The output can be sent to NewDict. +func (d *Dict) Bytes() []byte { + dst := make([]byte, binary.MaxVarintLen16+len(d.dict)) + return append(dst[:binary.PutUvarint(dst, uint64(d.repeat))], d.dict...) +} + +// MakeDict will create a dictionary. +// 'data' must be at least MinDictSize. +// If data is longer than MaxDictSize only the last MaxDictSize bytes will be used. +// If searchStart is set the start repeat value will be set to the last +// match of this content. +// If no matches are found, it will attempt to find shorter matches. +// This content should match the typical start of a block. +// If at least 4 bytes cannot be matched, repeat is set to start of block. +func MakeDict(data []byte, searchStart []byte) *Dict { + if len(data) == 0 { + return nil + } + if len(data) > MaxDictSize { + data = data[len(data)-MaxDictSize:] + } + var d Dict + dict := data + d.dict = dict + if cap(d.dict) < len(d.dict)+16 { + d.dict = append(make([]byte, 0, len(d.dict)+16), d.dict...) + } + if len(dict) < MinDictSize { + return nil + } + + // Find the longest match possible, last entry if multiple. + for s := len(searchStart); s > 4; s-- { + if idx := bytes.LastIndex(data, searchStart[:s]); idx >= 0 && idx <= len(data)-8 { + d.repeat = idx + break + } + } + + return &d +} + +// Encode returns the encoded form of src. The returned slice may be a sub- +// slice of dst if dst was large enough to hold the entire encoded block. +// Otherwise, a newly allocated slice will be returned. +// +// The dst and src must not overlap. It is valid to pass a nil dst. +// +// The blocks will require the same amount of memory to decode as encoding, +// and does not make for concurrent decoding. +// Also note that blocks do not contain CRC information, so corruption may be undetected. +// +// If you need to encode larger amounts of data, consider using +// the streaming interface which gives all of these features. +func (d *Dict) Encode(dst, src []byte) []byte { + if n := MaxEncodedLen(len(src)); n < 0 { + panic(ErrTooLarge) + } else if cap(dst) < n { + dst = make([]byte, n) + } else { + dst = dst[:n] + } + + // The block starts with the varint-encoded length of the decompressed bytes. + dstP := binary.PutUvarint(dst, uint64(len(src))) + + if len(src) == 0 { + return dst[:dstP] + } + if len(src) < minNonLiteralBlockSize { + dstP += emitLiteral(dst[dstP:], src) + return dst[:dstP] + } + n := encodeBlockDictGo(dst[dstP:], src, d) + if n > 0 { + dstP += n + return dst[:dstP] + } + // Not compressible + dstP += emitLiteral(dst[dstP:], src) + return dst[:dstP] +} + +// EncodeBetter returns the encoded form of src. The returned slice may be a sub- +// slice of dst if dst was large enough to hold the entire encoded block. +// Otherwise, a newly allocated slice will be returned. +// +// EncodeBetter compresses better than Encode but typically with a +// 10-40% speed decrease on both compression and decompression. +// +// The dst and src must not overlap. It is valid to pass a nil dst. +// +// The blocks will require the same amount of memory to decode as encoding, +// and does not make for concurrent decoding. +// Also note that blocks do not contain CRC information, so corruption may be undetected. +// +// If you need to encode larger amounts of data, consider using +// the streaming interface which gives all of these features. +func (d *Dict) EncodeBetter(dst, src []byte) []byte { + if n := MaxEncodedLen(len(src)); n < 0 { + panic(ErrTooLarge) + } else if len(dst) < n { + dst = make([]byte, n) + } + + // The block starts with the varint-encoded length of the decompressed bytes. + dstP := binary.PutUvarint(dst, uint64(len(src))) + + if len(src) == 0 { + return dst[:dstP] + } + if len(src) < minNonLiteralBlockSize { + dstP += emitLiteral(dst[dstP:], src) + return dst[:dstP] + } + n := encodeBlockBetterDict(dst[dstP:], src, d) + if n > 0 { + dstP += n + return dst[:dstP] + } + // Not compressible + dstP += emitLiteral(dst[dstP:], src) + return dst[:dstP] +} + +// EncodeBest returns the encoded form of src. The returned slice may be a sub- +// slice of dst if dst was large enough to hold the entire encoded block. +// Otherwise, a newly allocated slice will be returned. +// +// EncodeBest compresses as good as reasonably possible but with a +// big speed decrease. +// +// The dst and src must not overlap. It is valid to pass a nil dst. +// +// The blocks will require the same amount of memory to decode as encoding, +// and does not make for concurrent decoding. +// Also note that blocks do not contain CRC information, so corruption may be undetected. +// +// If you need to encode larger amounts of data, consider using +// the streaming interface which gives all of these features. +func (d *Dict) EncodeBest(dst, src []byte) []byte { + if n := MaxEncodedLen(len(src)); n < 0 { + panic(ErrTooLarge) + } else if len(dst) < n { + dst = make([]byte, n) + } + + // The block starts with the varint-encoded length of the decompressed bytes. + dstP := binary.PutUvarint(dst, uint64(len(src))) + + if len(src) == 0 { + return dst[:dstP] + } + if len(src) < minNonLiteralBlockSize { + dstP += emitLiteral(dst[dstP:], src) + return dst[:dstP] + } + n := encodeBlockBest(dst[dstP:], src, d) + if n > 0 { + dstP += n + return dst[:dstP] + } + // Not compressible + dstP += emitLiteral(dst[dstP:], src) + return dst[:dstP] +} + +// Decode returns the decoded form of src. The returned slice may be a sub- +// slice of dst if dst was large enough to hold the entire decoded block. +// Otherwise, a newly allocated slice will be returned. +// +// The dst and src must not overlap. It is valid to pass a nil dst. +func (d *Dict) Decode(dst, src []byte) ([]byte, error) { + dLen, s, err := decodedLen(src) + if err != nil { + return nil, err + } + if dLen <= cap(dst) { + dst = dst[:dLen] + } else { + dst = make([]byte, dLen) + } + if s2DecodeDict(dst, src[s:], d) != 0 { + return nil, ErrCorrupt + } + return dst, nil +} + +func (d *Dict) initFast() { + d.fast.Do(func() { + const ( + tableBits = 14 + maxTableSize = 1 << tableBits + ) + + var table [maxTableSize]uint16 + // We stop so any entry of length 8 can always be read. + for i := 0; i < len(d.dict)-8-2; i += 3 { + x0 := load64(d.dict, i) + h0 := hash6(x0, tableBits) + h1 := hash6(x0>>8, tableBits) + h2 := hash6(x0>>16, tableBits) + table[h0] = uint16(i) + table[h1] = uint16(i + 1) + table[h2] = uint16(i + 2) + } + d.fastTable = &table + }) +} + +func (d *Dict) initBetter() { + d.better.Do(func() { + const ( + // Long hash matches. + lTableBits = 17 + maxLTableSize = 1 << lTableBits + + // Short hash matches. + sTableBits = 14 + maxSTableSize = 1 << sTableBits + ) + + var lTable [maxLTableSize]uint16 + var sTable [maxSTableSize]uint16 + + // We stop so any entry of length 8 can always be read. + for i := 0; i < len(d.dict)-8; i++ { + cv := load64(d.dict, i) + lTable[hash7(cv, lTableBits)] = uint16(i) + sTable[hash4(cv, sTableBits)] = uint16(i) + } + d.betterTableShort = &sTable + d.betterTableLong = &lTable + }) +} + +func (d *Dict) initBest() { + d.best.Do(func() { + const ( + // Long hash matches. + lTableBits = 19 + maxLTableSize = 1 << lTableBits + + // Short hash matches. + sTableBits = 16 + maxSTableSize = 1 << sTableBits + ) + + var lTable [maxLTableSize]uint32 + var sTable [maxSTableSize]uint32 + + // We stop so any entry of length 8 can always be read. + for i := 0; i < len(d.dict)-8; i++ { + cv := load64(d.dict, i) + hashL := hash8(cv, lTableBits) + hashS := hash4(cv, sTableBits) + candidateL := lTable[hashL] + candidateS := sTable[hashS] + lTable[hashL] = uint32(i) | candidateL<<16 + sTable[hashS] = uint32(i) | candidateS<<16 + } + d.bestTableShort = &sTable + d.bestTableLong = &lTable + }) +} diff --git a/vendor/github.com/klauspost/compress/s2/encode.go b/vendor/github.com/klauspost/compress/s2/encode.go index 1aefabf3..c2ca7236 100644 --- a/vendor/github.com/klauspost/compress/s2/encode.go +++ b/vendor/github.com/klauspost/compress/s2/encode.go @@ -58,6 +58,32 @@ func Encode(dst, src []byte) []byte { return dst[:d] } +// EstimateBlockSize will perform a very fast compression +// without outputting the result and return the compressed output size. +// The function returns -1 if no improvement could be achieved. +// Using actual compression will most often produce better compression than the estimate. +func EstimateBlockSize(src []byte) (d int) { + if len(src) < 6 || int64(len(src)) > 0xffffffff { + return -1 + } + if len(src) <= 1024 { + d = calcBlockSizeSmall(src) + } else { + d = calcBlockSize(src) + } + + if d == 0 { + return -1 + } + // Size of the varint encoded block size. + d += (bits.Len64(uint64(len(src))) + 7) / 7 + + if d >= len(src) { + return -1 + } + return d +} + // EncodeBetter returns the encoded form of src. The returned slice may be a sub- // slice of dst if dst was large enough to hold the entire encoded block. // Otherwise, a newly allocated slice will be returned. @@ -132,7 +158,7 @@ func EncodeBest(dst, src []byte) []byte { d += emitLiteral(dst[d:], src) return dst[:d] } - n := encodeBlockBest(dst[d:], src) + n := encodeBlockBest(dst[d:], src, nil) if n > 0 { d += n return dst[:d] @@ -404,10 +430,11 @@ type Writer struct { buffers sync.Pool pad int - writer io.Writer - randSrc io.Reader - writerWg sync.WaitGroup - index Index + writer io.Writer + randSrc io.Reader + writerWg sync.WaitGroup + index Index + customEnc func(dst, src []byte) int // wroteStreamHeader is whether we have written the stream header. wroteStreamHeader bool @@ -773,6 +800,9 @@ func (w *Writer) EncodeBuffer(buf []byte) (err error) { } func (w *Writer) encodeBlock(obuf, uncompressed []byte) int { + if w.customEnc != nil { + return w.customEnc(obuf, uncompressed) + } if w.snappy { switch w.level { case levelFast: @@ -790,7 +820,7 @@ func (w *Writer) encodeBlock(obuf, uncompressed []byte) int { case levelBetter: return encodeBlockBetter(obuf, uncompressed) case levelBest: - return encodeBlockBest(obuf, uncompressed) + return encodeBlockBest(obuf, uncompressed, nil) } return 0 } @@ -1339,3 +1369,15 @@ func WriterFlushOnWrite() WriterOption { return nil } } + +// WriterCustomEncoder allows to override the encoder for blocks on the stream. +// The function must compress 'src' into 'dst' and return the bytes used in dst as an integer. +// Block size (initial varint) should not be added by the encoder. +// Returning value 0 indicates the block could not be compressed. +// The function should expect to be called concurrently. +func WriterCustomEncoder(fn func(dst, src []byte) int) WriterOption { + return func(w *Writer) error { + w.customEnc = fn + return nil + } +} diff --git a/vendor/github.com/klauspost/compress/s2/encode_all.go b/vendor/github.com/klauspost/compress/s2/encode_all.go index 8b16c38a..11657f09 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_all.go +++ b/vendor/github.com/klauspost/compress/s2/encode_all.go @@ -8,6 +8,7 @@ package s2 import ( "bytes" "encoding/binary" + "fmt" "math/bits" ) @@ -58,8 +59,9 @@ func encodeGo(dst, src []byte) []byte { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockGo(dst, src []byte) (d int) { // Initialize the hash table. const ( @@ -454,3 +456,594 @@ emitRemainder: } return d } + +// encodeBlockGo encodes a non-empty src to a guaranteed-large-enough dst. It +// assumes that the varint-encoded length of the decompressed bytes has already +// been written. +// +// It also assumes that: +// +// len(dst) >= MaxEncodedLen(len(src)) && +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +func encodeBlockDictGo(dst, src []byte, dict *Dict) (d int) { + // Initialize the hash table. + const ( + tableBits = 14 + maxTableSize = 1 << tableBits + maxAhead = 8 // maximum bytes ahead without checking sLimit + + debug = false + ) + dict.initFast() + + var table [maxTableSize]uint32 + + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + if sLimit > MaxDictSrcOffset-maxAhead { + sLimit = MaxDictSrcOffset - maxAhead + } + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 5 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form can start with a dict entry (copy or repeat). + s := 0 + + // Convert dict repeat to offset + repeat := len(dict.dict) - dict.repeat + cv := load64(src, 0) + + // While in dict +searchDict: + for { + // Next src position to check + nextS := s + (s-nextEmit)>>6 + 4 + hash0 := hash6(cv, tableBits) + hash1 := hash6(cv>>8, tableBits) + if nextS > sLimit { + if debug { + fmt.Println("slimit reached", s, nextS) + } + break searchDict + } + candidateDict := int(dict.fastTable[hash0]) + candidateDict2 := int(dict.fastTable[hash1]) + candidate2 := int(table[hash1]) + candidate := int(table[hash0]) + table[hash0] = uint32(s) + table[hash1] = uint32(s + 1) + hash2 := hash6(cv>>16, tableBits) + + // Check repeat at offset checkRep. + const checkRep = 1 + + if repeat > s { + candidate := len(dict.dict) - repeat + s + if repeat-s >= 4 && uint32(cv) == load32(dict.dict, candidate) { + // Extend back + base := s + for i := candidate; base > nextEmit && i > 0 && dict.dict[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteral(dst[d:], src[nextEmit:base]) + if debug && nextEmit != base { + fmt.Println("emitted ", base-nextEmit, "literals") + } + s += 4 + candidate += 4 + for candidate < len(dict.dict)-8 && s <= len(src)-8 { + if diff := load64(src, s) ^ load64(dict.dict, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + d += emitRepeat(dst[d:], repeat, s-base) + if debug { + fmt.Println("emitted dict repeat length", s-base, "offset:", repeat, "s:", s) + } + nextEmit = s + if s >= sLimit { + break searchDict + } + cv = load64(src, s) + continue + } + } else if uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteral(dst[d:], src[nextEmit:base]) + if debug && nextEmit != base { + fmt.Println("emitted ", base-nextEmit, "literals") + } + + // Extend forward + candidate := s - repeat + 4 + checkRep + s += 4 + checkRep + for s <= sLimit { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + if debug { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + + if nextEmit > 0 { + // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. + d += emitRepeat(dst[d:], repeat, s-base) + } else { + // First match, cannot be repeat. + d += emitCopy(dst[d:], repeat, s-base) + } + + nextEmit = s + if s >= sLimit { + break searchDict + } + if debug { + fmt.Println("emitted reg repeat", s-base, "s:", s) + } + cv = load64(src, s) + continue searchDict + } + if s == 0 { + cv = load64(src, nextS) + s = nextS + continue searchDict + } + // Start with table. These matches will always be closer. + if uint32(cv) == load32(src, candidate) { + goto emitMatch + } + candidate = int(table[hash2]) + if uint32(cv>>8) == load32(src, candidate2) { + table[hash2] = uint32(s + 2) + candidate = candidate2 + s++ + goto emitMatch + } + + // Check dict. Dicts have longer offsets, so we want longer matches. + if cv == load64(dict.dict, candidateDict) { + table[hash2] = uint32(s + 2) + goto emitDict + } + + candidateDict = int(dict.fastTable[hash2]) + // Check if upper 7 bytes match + if candidateDict2 >= 1 { + if cv^load64(dict.dict, candidateDict2-1) < (1 << 8) { + table[hash2] = uint32(s + 2) + candidateDict = candidateDict2 + s++ + goto emitDict + } + } + + table[hash2] = uint32(s + 2) + if uint32(cv>>16) == load32(src, candidate) { + s += 2 + goto emitMatch + } + if candidateDict >= 2 { + // Check if upper 6 bytes match + if cv^load64(dict.dict, candidateDict-2) < (1 << 16) { + s += 2 + goto emitDict + } + } + + cv = load64(src, nextS) + s = nextS + continue searchDict + + emitDict: + { + if debug { + if load32(dict.dict, candidateDict) != load32(src, s) { + panic("dict emit mismatch") + } + } + // Extend backwards. + // The top bytes will be rechecked to get the full match. + for candidateDict > 0 && s > nextEmit && dict.dict[candidateDict-1] == src[s-1] { + candidateDict-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteral(dst[d:], src[nextEmit:s]) + if debug && nextEmit != s { + fmt.Println("emitted ", s-nextEmit, "literals") + } + { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = s + (len(dict.dict)) - candidateDict + + // Extend the 4-byte match as long as possible. + s += 4 + candidateDict += 4 + for s <= len(src)-8 && len(dict.dict)-candidateDict >= 8 { + if diff := load64(src, s) ^ load64(dict.dict, candidateDict); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidateDict += 8 + } + + // Matches longer than 64 are split. + if s <= sLimit || s-base < 8 { + d += emitCopy(dst[d:], repeat, s-base) + } else { + // Split to ensure we don't start a copy within next block + d += emitCopy(dst[d:], repeat, 4) + d += emitRepeat(dst[d:], repeat, s-base-4) + } + if false { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := dict.dict[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + if debug { + fmt.Println("emitted dict copy, length", s-base, "offset:", repeat, "s:", s) + } + nextEmit = s + if s >= sLimit { + break searchDict + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + + // Index and continue loop to try new candidate. + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>8, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint32(s - 2) + table[currHash] = uint32(s - 1) + cv = load64(src, s) + } + continue + } + emitMatch: + + // Extend backwards. + // The top bytes will be rechecked to get the full match. + for candidate > 0 && s > nextEmit && src[candidate-1] == src[s-1] { + candidate-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteral(dst[d:], src[nextEmit:s]) + if debug && nextEmit != s { + fmt.Println("emitted ", s-nextEmit, "literals") + } + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = base - candidate + + // Extend the 4-byte match as long as possible. + s += 4 + candidate += 4 + for s <= len(src)-8 { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopy(dst[d:], repeat, s-base) + if debug { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + if debug { + fmt.Println("emitted src copy, length", s-base, "offset:", repeat, "s:", s) + } + nextEmit = s + if s >= sLimit { + break searchDict + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + // Check for an immediate match, otherwise start search at s+1 + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>16, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint32(s - 2) + table[currHash] = uint32(s) + if debug && s == candidate { + panic("s == candidate") + } + if uint32(x>>16) != load32(src, candidate) { + cv = load64(src, s+1) + s++ + break + } + } + } + + // Search without dict: + if repeat > s { + repeat = 0 + } + + // No more dict + sLimit = len(src) - inputMargin + if s >= sLimit { + goto emitRemainder + } + if debug { + fmt.Println("non-dict matching at", s, "repeat:", repeat) + } + cv = load64(src, s) + if debug { + fmt.Println("now", s, "->", sLimit, "out:", d, "left:", len(src)-s, "nextemit:", nextEmit, "dstLimit:", dstLimit, "s:", s) + } + for { + candidate := 0 + for { + // Next src position to check + nextS := s + (s-nextEmit)>>6 + 4 + if nextS > sLimit { + goto emitRemainder + } + hash0 := hash6(cv, tableBits) + hash1 := hash6(cv>>8, tableBits) + candidate = int(table[hash0]) + candidate2 := int(table[hash1]) + table[hash0] = uint32(s) + table[hash1] = uint32(s + 1) + hash2 := hash6(cv>>16, tableBits) + + // Check repeat at offset checkRep. + const checkRep = 1 + if repeat > 0 && uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteral(dst[d:], src[nextEmit:base]) + if debug && nextEmit != base { + fmt.Println("emitted ", base-nextEmit, "literals") + } + // Extend forward + candidate := s - repeat + 4 + checkRep + s += 4 + checkRep + for s <= sLimit { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + if debug { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + if nextEmit > 0 { + // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. + d += emitRepeat(dst[d:], repeat, s-base) + } else { + // First match, cannot be repeat. + d += emitCopy(dst[d:], repeat, s-base) + } + if debug { + fmt.Println("emitted src repeat length", s-base, "offset:", repeat, "s:", s) + } + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + cv = load64(src, s) + continue + } + + if uint32(cv) == load32(src, candidate) { + break + } + candidate = int(table[hash2]) + if uint32(cv>>8) == load32(src, candidate2) { + table[hash2] = uint32(s + 2) + candidate = candidate2 + s++ + break + } + table[hash2] = uint32(s + 2) + if uint32(cv>>16) == load32(src, candidate) { + s += 2 + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards. + // The top bytes will be rechecked to get the full match. + for candidate > 0 && s > nextEmit && src[candidate-1] == src[s-1] { + candidate-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteral(dst[d:], src[nextEmit:s]) + if debug && nextEmit != s { + fmt.Println("emitted ", s-nextEmit, "literals") + } + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = base - candidate + + // Extend the 4-byte match as long as possible. + s += 4 + candidate += 4 + for s <= len(src)-8 { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopy(dst[d:], repeat, s-base) + if debug { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + if debug { + fmt.Println("emitted src copy, length", s-base, "offset:", repeat, "s:", s) + } + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + // Check for an immediate match, otherwise start search at s+1 + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>16, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint32(s - 2) + table[currHash] = uint32(s) + if debug && s == candidate { + panic("s == candidate") + } + if uint32(x>>16) != load32(src, candidate) { + cv = load64(src, s+1) + s++ + break + } + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteral(dst[d:], src[nextEmit:]) + if debug && nextEmit != s { + fmt.Println("emitted ", len(src)-nextEmit, "literals") + } + } + return d +} diff --git a/vendor/github.com/klauspost/compress/s2/encode_amd64.go b/vendor/github.com/klauspost/compress/s2/encode_amd64.go index e612225f..ebc332ad 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_amd64.go +++ b/vendor/github.com/klauspost/compress/s2/encode_amd64.go @@ -3,13 +3,16 @@ package s2 +const hasAmd64Asm = true + // encodeBlock encodes a non-empty src to a guaranteed-large-enough dst. It // assumes that the varint-encoded length of the decompressed bytes has already // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlock(dst, src []byte) (d int) { const ( // Use 12 bit table when less than... @@ -43,8 +46,9 @@ func encodeBlock(dst, src []byte) (d int) { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockBetter(dst, src []byte) (d int) { const ( // Use 12 bit table when less than... @@ -78,8 +82,9 @@ func encodeBlockBetter(dst, src []byte) (d int) { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockSnappy(dst, src []byte) (d int) { const ( // Use 12 bit table when less than... @@ -112,8 +117,9 @@ func encodeBlockSnappy(dst, src []byte) (d int) { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockBetterSnappy(dst, src []byte) (d int) { const ( // Use 12 bit table when less than... diff --git a/vendor/github.com/klauspost/compress/s2/encode_best.go b/vendor/github.com/klauspost/compress/s2/encode_best.go index 4bc80bc6..1d13e869 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_best.go +++ b/vendor/github.com/klauspost/compress/s2/encode_best.go @@ -7,6 +7,7 @@ package s2 import ( "fmt" + "math" "math/bits" ) @@ -15,9 +16,10 @@ import ( // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize -func encodeBlockBest(dst, src []byte) (d int) { +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +func encodeBlockBest(dst, src []byte, dict *Dict) (d int) { // Initialize the hash tables. const ( // Long hash matches. @@ -29,6 +31,8 @@ func encodeBlockBest(dst, src []byte) (d int) { maxSTableSize = 1 << sTableBits inputMargin = 8 + 2 + + debug = false ) // sLimit is when to stop looking for offset/length copies. The inputMargin @@ -38,6 +42,10 @@ func encodeBlockBest(dst, src []byte) (d int) { if len(src) < minNonLiteralBlockSize { return 0 } + sLimitDict := len(src) - inputMargin + if sLimitDict > MaxDictSrcOffset-inputMargin { + sLimitDict = MaxDictSrcOffset - inputMargin + } var lTable [maxLTableSize]uint64 var sTable [maxSTableSize]uint64 @@ -51,10 +59,15 @@ func encodeBlockBest(dst, src []byte) (d int) { // The encoded form must start with a literal, as there are no previous // bytes to copy, so we start looking for hash matches at s == 1. s := 1 + repeat := 1 + if dict != nil { + dict.initBest() + s = 0 + repeat = len(dict.dict) - dict.repeat + } cv := load64(src, s) // We search for a repeat at -1, but don't output repeats when nextEmit == 0 - repeat := 1 const lowbitMask = 0xffffffff getCur := func(x uint64) int { return int(x & lowbitMask) @@ -66,11 +79,11 @@ func encodeBlockBest(dst, src []byte) (d int) { for { type match struct { - offset int - s int - length int - score int - rep bool + offset int + s int + length int + score int + rep, dict bool } var best match for { @@ -84,6 +97,12 @@ func encodeBlockBest(dst, src []byte) (d int) { if nextS > sLimit { goto emitRemainder } + if dict != nil && s >= MaxDictSrcOffset { + dict = nil + if repeat > s { + repeat = math.MinInt32 + } + } hashL := hash8(cv, lTableBits) hashS := hash4(cv, sTableBits) candidateL := lTable[hashL] @@ -113,7 +132,15 @@ func encodeBlockBest(dst, src []byte) (d int) { } m := match{offset: offset, s: s, length: 4 + offset, rep: rep} s += 4 - for s <= sLimit { + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[m.length] { + m.length++ + s++ + continue + } + break + } if diff := load64(src, s) ^ load64(src, m.length); diff != 0 { m.length += bits.TrailingZeros64(diff) >> 3 break @@ -129,6 +156,62 @@ func encodeBlockBest(dst, src []byte) (d int) { } return m } + matchDict := func(candidate, s int, first uint32, rep bool) match { + // Calculate offset as if in continuous array with s + offset := -len(dict.dict) + candidate + if best.length != 0 && best.s-best.offset == s-offset && !rep { + // Don't retest if we have the same offset. + return match{offset: offset, s: s} + } + + if load32(dict.dict, candidate) != first { + return match{offset: offset, s: s} + } + m := match{offset: offset, s: s, length: 4 + candidate, rep: rep, dict: true} + s += 4 + if !rep { + for s < sLimitDict && m.length < len(dict.dict) { + if len(src)-s < 8 || len(dict.dict)-m.length < 8 { + if src[s] == dict.dict[m.length] { + m.length++ + s++ + continue + } + break + } + if diff := load64(src, s) ^ load64(dict.dict, m.length); diff != 0 { + m.length += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + m.length += 8 + } + } else { + for s < len(src) && m.length < len(dict.dict) { + if len(src)-s < 8 || len(dict.dict)-m.length < 8 { + if src[s] == dict.dict[m.length] { + m.length++ + s++ + continue + } + break + } + if diff := load64(src, s) ^ load64(dict.dict, m.length); diff != 0 { + m.length += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + m.length += 8 + } + } + m.length -= candidate + m.score = score(m) + if m.score <= -m.s { + // Eliminate if no savings, we might find a better one. + m.length = 0 + } + return m + } bestOf := func(a, b match) match { if b.length == 0 { @@ -145,45 +228,99 @@ func encodeBlockBest(dst, src []byte) (d int) { return b } - best = bestOf(matchAt(getCur(candidateL), s, uint32(cv), false), matchAt(getPrev(candidateL), s, uint32(cv), false)) - best = bestOf(best, matchAt(getCur(candidateS), s, uint32(cv), false)) - best = bestOf(best, matchAt(getPrev(candidateS), s, uint32(cv), false)) - + if s > 0 { + best = bestOf(matchAt(getCur(candidateL), s, uint32(cv), false), matchAt(getPrev(candidateL), s, uint32(cv), false)) + best = bestOf(best, matchAt(getCur(candidateS), s, uint32(cv), false)) + best = bestOf(best, matchAt(getPrev(candidateS), s, uint32(cv), false)) + } + if dict != nil { + candidateL := dict.bestTableLong[hashL] + candidateS := dict.bestTableShort[hashS] + best = bestOf(best, matchDict(int(candidateL&0xffff), s, uint32(cv), false)) + best = bestOf(best, matchDict(int(candidateL>>16), s, uint32(cv), false)) + best = bestOf(best, matchDict(int(candidateS&0xffff), s, uint32(cv), false)) + best = bestOf(best, matchDict(int(candidateS>>16), s, uint32(cv), false)) + } { - best = bestOf(best, matchAt(s-repeat+1, s+1, uint32(cv>>8), true)) + if (dict == nil || repeat <= s) && repeat > 0 { + best = bestOf(best, matchAt(s-repeat+1, s+1, uint32(cv>>8), true)) + } else if s-repeat < -4 && dict != nil { + candidate := len(dict.dict) - (repeat - s) + best = bestOf(best, matchDict(candidate, s, uint32(cv), true)) + candidate++ + best = bestOf(best, matchDict(candidate, s+1, uint32(cv>>8), true)) + } + if best.length > 0 { + hashS := hash4(cv>>8, sTableBits) // s+1 - nextShort := sTable[hash4(cv>>8, sTableBits)] + nextShort := sTable[hashS] s := s + 1 cv := load64(src, s) - nextLong := lTable[hash8(cv, lTableBits)] + hashL := hash8(cv, lTableBits) + nextLong := lTable[hashL] best = bestOf(best, matchAt(getCur(nextShort), s, uint32(cv), false)) best = bestOf(best, matchAt(getPrev(nextShort), s, uint32(cv), false)) best = bestOf(best, matchAt(getCur(nextLong), s, uint32(cv), false)) best = bestOf(best, matchAt(getPrev(nextLong), s, uint32(cv), false)) - // Repeat at + 2 - best = bestOf(best, matchAt(s-repeat+1, s+1, uint32(cv>>8), true)) + + // Dict at + 1 + if dict != nil { + candidateL := dict.bestTableLong[hashL] + candidateS := dict.bestTableShort[hashS] + + best = bestOf(best, matchDict(int(candidateL&0xffff), s, uint32(cv), false)) + best = bestOf(best, matchDict(int(candidateS&0xffff), s, uint32(cv), false)) + } // s+2 if true { - nextShort = sTable[hash4(cv>>8, sTableBits)] + hashS := hash4(cv>>8, sTableBits) + + nextShort = sTable[hashS] s++ cv = load64(src, s) - nextLong = lTable[hash8(cv, lTableBits)] + hashL := hash8(cv, lTableBits) + nextLong = lTable[hashL] + + if (dict == nil || repeat <= s) && repeat > 0 { + // Repeat at + 2 + best = bestOf(best, matchAt(s-repeat, s, uint32(cv), true)) + } else if repeat-s > 4 && dict != nil { + candidate := len(dict.dict) - (repeat - s) + best = bestOf(best, matchDict(candidate, s, uint32(cv), true)) + } best = bestOf(best, matchAt(getCur(nextShort), s, uint32(cv), false)) best = bestOf(best, matchAt(getPrev(nextShort), s, uint32(cv), false)) best = bestOf(best, matchAt(getCur(nextLong), s, uint32(cv), false)) best = bestOf(best, matchAt(getPrev(nextLong), s, uint32(cv), false)) + + // Dict at +2 + // Very small gain + if dict != nil { + candidateL := dict.bestTableLong[hashL] + candidateS := dict.bestTableShort[hashS] + + best = bestOf(best, matchDict(int(candidateL&0xffff), s, uint32(cv), false)) + best = bestOf(best, matchDict(int(candidateS&0xffff), s, uint32(cv), false)) + } } // Search for a match at best match end, see if that is better. - if sAt := best.s + best.length; sAt < sLimit { - sBack := best.s - backL := best.length + // Allow some bytes at the beginning to mismatch. + // Sweet spot is around 1-2 bytes, but depends on input. + // The skipped bytes are tested in Extend backwards, + // and still picked up as part of the match if they do. + const skipBeginning = 2 + const skipEnd = 1 + if sAt := best.s + best.length - skipEnd; sAt < sLimit { + + sBack := best.s + skipBeginning - skipEnd + backL := best.length - skipBeginning // Load initial values cv = load64(src, sBack) - // Search for mismatch + + // Grab candidates... next := lTable[hash8(load64(src, sAt), lTableBits)] - //next := sTable[hash4(load64(src, sAt), sTableBits)] if checkAt := getCur(next) - backL; checkAt > 0 { best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false)) @@ -191,6 +328,16 @@ func encodeBlockBest(dst, src []byte) (d int) { if checkAt := getPrev(next) - backL; checkAt > 0 { best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false)) } + // Disabled: Extremely small gain + if false { + next = sTable[hash4(load64(src, sAt), sTableBits)] + if checkAt := getCur(next) - backL; checkAt > 0 { + best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false)) + } + if checkAt := getPrev(next) - backL; checkAt > 0 { + best = bestOf(best, matchAt(checkAt, sBack, uint32(cv), false)) + } + } } } } @@ -209,7 +356,7 @@ func encodeBlockBest(dst, src []byte) (d int) { // Extend backwards, not needed for repeats... s = best.s - if !best.rep { + if !best.rep && !best.dict { for best.offset > 0 && s > nextEmit && src[best.offset-1] == src[s-1] { best.offset-- best.length++ @@ -226,7 +373,6 @@ func encodeBlockBest(dst, src []byte) (d int) { base := s offset := s - best.offset - s += best.length if offset > 65535 && s-base <= 5 && !best.rep { @@ -238,16 +384,28 @@ func encodeBlockBest(dst, src []byte) (d int) { cv = load64(src, s) continue } + if debug && nextEmit != base { + fmt.Println("EMIT", base-nextEmit, "literals. base-after:", base) + } d += emitLiteral(dst[d:], src[nextEmit:base]) if best.rep { - if nextEmit > 0 { + if nextEmit > 0 || best.dict { + if debug { + fmt.Println("REPEAT, length", best.length, "offset:", offset, "s-after:", s, "dict:", best.dict, "best:", best) + } // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. d += emitRepeat(dst[d:], offset, best.length) } else { - // First match, cannot be repeat. + // First match without dict cannot be a repeat. + if debug { + fmt.Println("COPY, length", best.length, "offset:", offset, "s-after:", s, "dict:", best.dict, "best:", best) + } d += emitCopy(dst[d:], offset, best.length) } } else { + if debug { + fmt.Println("COPY, length", best.length, "offset:", offset, "s-after:", s, "dict:", best.dict, "best:", best) + } d += emitCopy(dst[d:], offset, best.length) } repeat = offset @@ -278,6 +436,9 @@ emitRemainder: if d+len(src)-nextEmit > dstLimit { return 0 } + if debug && nextEmit != s { + fmt.Println("emitted ", len(src)-nextEmit, "literals") + } d += emitLiteral(dst[d:], src[nextEmit:]) } return d @@ -288,8 +449,9 @@ emitRemainder: // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockBestSnappy(dst, src []byte) (d int) { // Initialize the hash tables. const ( @@ -546,6 +708,7 @@ emitRemainder: // emitCopySize returns the size to encode the offset+length // // It assumes that: +// // 1 <= offset && offset <= math.MaxUint32 // 4 <= length && length <= 1 << 24 func emitCopySize(offset, length int) int { @@ -584,6 +747,7 @@ func emitCopySize(offset, length int) int { // emitCopyNoRepeatSize returns the size to encode the offset+length // // It assumes that: +// // 1 <= offset && offset <= math.MaxUint32 // 4 <= length && length <= 1 << 24 func emitCopyNoRepeatSize(offset, length int) int { @@ -621,7 +785,6 @@ func emitRepeatSize(offset, length int) int { left := 0 if length > maxRepeat { left = length - maxRepeat + 4 - length = maxRepeat - 4 } if left > 0 { return 5 + emitRepeatSize(offset, left) diff --git a/vendor/github.com/klauspost/compress/s2/encode_better.go b/vendor/github.com/klauspost/compress/s2/encode_better.go index 943215b8..f46adb41 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_better.go +++ b/vendor/github.com/klauspost/compress/s2/encode_better.go @@ -6,6 +6,8 @@ package s2 import ( + "bytes" + "fmt" "math/bits" ) @@ -42,8 +44,9 @@ func hash8(u uint64, h uint8) uint32 { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockBetterGo(dst, src []byte) (d int) { // sLimit is when to stop looking for offset/length copies. The inputMargin // lets us use a fast path for emitLiteral in the main loop, while we are @@ -56,7 +59,7 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { // Initialize the hash tables. const ( // Long hash matches. - lTableBits = 16 + lTableBits = 17 maxLTableSize = 1 << lTableBits // Short hash matches. @@ -97,9 +100,26 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { lTable[hashL] = uint32(s) sTable[hashS] = uint32(s) + valLong := load64(src, candidateL) + valShort := load64(src, candidateS) + + // If long matches at least 8 bytes, use that. + if cv == valLong { + break + } + if cv == valShort { + candidateL = candidateS + break + } + // Check repeat at offset checkRep. const checkRep = 1 - if false && uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + // Minimum length of a repeat. Tested with various values. + // While 4-5 offers improvements in some, 6 reduces + // regressions significantly. + const wantRepeatBytes = 6 + const repeatMask = ((1 << (wantRepeatBytes * 8)) - 1) << (8 * checkRep) + if false && repeat > 0 && cv&repeatMask == load64(src, s-repeat)&repeatMask { base := s + checkRep // Extend back for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { @@ -109,8 +129,8 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { d += emitLiteral(dst[d:], src[nextEmit:base]) // Extend forward - candidate := s - repeat + 4 + checkRep - s += 4 + checkRep + candidate := s - repeat + wantRepeatBytes + checkRep + s += wantRepeatBytes + checkRep for s < len(src) { if len(src)-s < 8 { if src[s] == src[candidate] { @@ -127,28 +147,40 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { s += 8 candidate += 8 } - if nextEmit > 0 { - // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. - d += emitRepeat(dst[d:], repeat, s-base) - } else { - // First match, cannot be repeat. - d += emitCopy(dst[d:], repeat, s-base) - } + // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. + d += emitRepeat(dst[d:], repeat, s-base) nextEmit = s if s >= sLimit { goto emitRemainder } + // Index in-between + index0 := base + 1 + index1 := s - 2 + + cv = load64(src, s) + for index0 < index1 { + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint32(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 2 + index1 -= 2 + } cv = load64(src, s) continue } - if uint32(cv) == load32(src, candidateL) { + // Long likely matches 7, so take that. + if uint32(cv) == uint32(valLong) { break } // Check our short candidate - if uint32(cv) == load32(src, candidateS) { + if uint32(cv) == uint32(valShort) { // Try a long candidate at s+1 hashL = hash7(cv>>8, lTableBits) candidateL = int(lTable[hashL]) @@ -227,21 +259,29 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { // Do we have space for more, if not bail. return 0 } - // Index match start+1 (long) and start+2 (short) + + // Index short & long index0 := base + 1 - // Index match end-2 (long) and end-1 (short) index1 := s - 2 cv0 := load64(src, index0) cv1 := load64(src, index1) - cv = load64(src, s) lTable[hash7(cv0, lTableBits)] = uint32(index0) - lTable[hash7(cv0>>8, lTableBits)] = uint32(index0 + 1) - lTable[hash7(cv1, lTableBits)] = uint32(index1) - lTable[hash7(cv1>>8, lTableBits)] = uint32(index1 + 1) sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) - sTable[hash4(cv0>>16, sTableBits)] = uint32(index0 + 2) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // index every second long in between. + for index0 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) + lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + index0 += 2 + index1 -= 2 + } } emitRemainder: @@ -260,8 +300,9 @@ emitRemainder: // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) && -// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize func encodeBlockBetterSnappyGo(dst, src []byte) (d int) { // sLimit is when to stop looking for offset/length copies. The inputMargin // lets us use a fast path for emitLiteral in the main loop, while we are @@ -402,21 +443,649 @@ func encodeBlockBetterSnappyGo(dst, src []byte) (d int) { // Do we have space for more, if not bail. return 0 } - // Index match start+1 (long) and start+2 (short) + + // Index short & long index0 := base + 1 - // Index match end-2 (long) and end-1 (short) index1 := s - 2 cv0 := load64(src, index0) cv1 := load64(src, index1) - cv = load64(src, s) lTable[hash7(cv0, lTableBits)] = uint32(index0) - lTable[hash7(cv0>>8, lTableBits)] = uint32(index0 + 1) - lTable[hash7(cv1, lTableBits)] = uint32(index1) - lTable[hash7(cv1>>8, lTableBits)] = uint32(index1 + 1) sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) - sTable[hash4(cv0>>16, sTableBits)] = uint32(index0 + 2) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // index every second long in between. + for index0 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) + lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + index0 += 2 + index1 -= 2 + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteral(dst[d:], src[nextEmit:]) + } + return d +} + +// encodeBlockBetterDict encodes a non-empty src to a guaranteed-large-enough dst. It +// assumes that the varint-encoded length of the decompressed bytes has already +// been written. +// +// It also assumes that: +// +// len(dst) >= MaxEncodedLen(len(src)) && +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +func encodeBlockBetterDict(dst, src []byte, dict *Dict) (d int) { + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + // Initialize the hash tables. + const ( + // Long hash matches. + lTableBits = 17 + maxLTableSize = 1 << lTableBits + + // Short hash matches. + sTableBits = 14 + maxSTableSize = 1 << sTableBits + + maxAhead = 8 // maximum bytes ahead without checking sLimit + + debug = false + ) + + sLimit := len(src) - inputMargin + if sLimit > MaxDictSrcOffset-maxAhead { + sLimit = MaxDictSrcOffset - maxAhead + } + if len(src) < minNonLiteralBlockSize { + return 0 + } + + dict.initBetter() + + var lTable [maxLTableSize]uint32 + var sTable [maxSTableSize]uint32 + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 6 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 0 + cv := load64(src, s) + + // We initialize repeat to 0, so we never match on first attempt + repeat := len(dict.dict) - dict.repeat + + // While in dict +searchDict: + for { + candidateL := 0 + nextS := 0 + for { + // Next src position to check + nextS = s + (s-nextEmit)>>7 + 1 + if nextS > sLimit { + break searchDict + } + hashL := hash7(cv, lTableBits) + hashS := hash4(cv, sTableBits) + candidateL = int(lTable[hashL]) + candidateS := int(sTable[hashS]) + dictL := int(dict.betterTableLong[hashL]) + dictS := int(dict.betterTableShort[hashS]) + lTable[hashL] = uint32(s) + sTable[hashS] = uint32(s) + + valLong := load64(src, candidateL) + valShort := load64(src, candidateS) + + // If long matches at least 8 bytes, use that. + if s != 0 { + if cv == valLong { + goto emitMatch + } + if cv == valShort { + candidateL = candidateS + goto emitMatch + } + } + + // Check dict repeat. + if repeat >= s+4 { + candidate := len(dict.dict) - repeat + s + if candidate > 0 && uint32(cv) == load32(dict.dict, candidate) { + // Extend back + base := s + for i := candidate; base > nextEmit && i > 0 && dict.dict[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteral(dst[d:], src[nextEmit:base]) + if debug && nextEmit != base { + fmt.Println("emitted ", base-nextEmit, "literals") + } + s += 4 + candidate += 4 + for candidate < len(dict.dict)-8 && s <= len(src)-8 { + if diff := load64(src, s) ^ load64(dict.dict, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + d += emitRepeat(dst[d:], repeat, s-base) + if debug { + fmt.Println("emitted dict repeat length", s-base, "offset:", repeat, "s:", s) + } + nextEmit = s + if s >= sLimit { + break searchDict + } + cv = load64(src, s) + // Index in-between + index0 := base + 1 + index1 := s - 2 + + cv = load64(src, s) + for index0 < index1 { + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint32(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 2 + index1 -= 2 + } + continue + } + } + // Don't try to find match at s==0 + if s == 0 { + cv = load64(src, nextS) + s = nextS + continue + } + + // Long likely matches 7, so take that. + if uint32(cv) == uint32(valLong) { + goto emitMatch + } + + // Long dict... + if uint32(cv) == load32(dict.dict, dictL) { + candidateL = dictL + goto emitDict + } + + // Check our short candidate + if uint32(cv) == uint32(valShort) { + // Try a long candidate at s+1 + hashL = hash7(cv>>8, lTableBits) + candidateL = int(lTable[hashL]) + lTable[hashL] = uint32(s + 1) + if uint32(cv>>8) == load32(src, candidateL) { + s++ + goto emitMatch + } + // Use our short candidate. + candidateL = candidateS + goto emitMatch + } + if uint32(cv) == load32(dict.dict, dictS) { + // Try a long candidate at s+1 + hashL = hash7(cv>>8, lTableBits) + candidateL = int(lTable[hashL]) + lTable[hashL] = uint32(s + 1) + if uint32(cv>>8) == load32(src, candidateL) { + s++ + goto emitMatch + } + candidateL = dictS + goto emitDict + } + cv = load64(src, nextS) + s = nextS + } + emitDict: + { + if debug { + if load32(dict.dict, candidateL) != load32(src, s) { + panic("dict emit mismatch") + } + } + // Extend backwards. + // The top bytes will be rechecked to get the full match. + for candidateL > 0 && s > nextEmit && dict.dict[candidateL-1] == src[s-1] { + candidateL-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteral(dst[d:], src[nextEmit:s]) + if debug && nextEmit != s { + fmt.Println("emitted ", s-nextEmit, "literals") + } + { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + offset := s + (len(dict.dict)) - candidateL + + // Extend the 4-byte match as long as possible. + s += 4 + candidateL += 4 + for s <= len(src)-8 && len(dict.dict)-candidateL >= 8 { + if diff := load64(src, s) ^ load64(dict.dict, candidateL); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidateL += 8 + } + + if repeat == offset { + if debug { + fmt.Println("emitted dict repeat, length", s-base, "offset:", offset, "s:", s, "dict offset:", candidateL) + } + d += emitRepeat(dst[d:], offset, s-base) + } else { + if debug { + fmt.Println("emitted dict copy, length", s-base, "offset:", offset, "s:", s, "dict offset:", candidateL) + } + // Matches longer than 64 are split. + if s <= sLimit || s-base < 8 { + d += emitCopy(dst[d:], offset, s-base) + } else { + // Split to ensure we don't start a copy within next block. + d += emitCopy(dst[d:], offset, 4) + d += emitRepeat(dst[d:], offset, s-base-4) + } + repeat = offset + } + if false { + // Validate match. + if s <= candidateL { + panic("s <= candidate") + } + a := src[base:s] + b := dict.dict[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + + nextEmit = s + if s >= sLimit { + break searchDict + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + + // Index short & long + index0 := base + 1 + index1 := s - 2 + + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint32(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // index every second long in between. + for index0 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) + lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + index0 += 2 + index1 -= 2 + } + } + continue + } + emitMatch: + + // Extend backwards + for candidateL > 0 && s > nextEmit && src[candidateL-1] == src[s-1] { + candidateL-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + base := s + offset := base - candidateL + + // Extend the 4-byte match as long as possible. + s += 4 + candidateL += 4 + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[candidateL] { + s++ + candidateL++ + continue + } + break + } + if diff := load64(src, s) ^ load64(src, candidateL); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidateL += 8 + } + + if offset > 65535 && s-base <= 5 && repeat != offset { + // Bail if the match is equal or worse to the encoding. + s = nextS + 1 + if s >= sLimit { + goto emitRemainder + } + cv = load64(src, s) + continue + } + + d += emitLiteral(dst[d:], src[nextEmit:base]) + if debug && nextEmit != s { + fmt.Println("emitted ", s-nextEmit, "literals") + } + if repeat == offset { + if debug { + fmt.Println("emitted match repeat, length", s-base, "offset:", offset, "s:", s) + } + d += emitRepeat(dst[d:], offset, s-base) + } else { + if debug { + fmt.Println("emitted match copy, length", s-base, "offset:", offset, "s:", s) + } + d += emitCopy(dst[d:], offset, s-base) + repeat = offset + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + + // Index short & long + index0 := base + 1 + index1 := s - 2 + + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint32(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // index every second long in between. + for index0 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) + lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + index0 += 2 + index1 -= 2 + } + } + + // Search without dict: + if repeat > s { + repeat = 0 + } + + // No more dict + sLimit = len(src) - inputMargin + if s >= sLimit { + goto emitRemainder + } + cv = load64(src, s) + if debug { + fmt.Println("now", s, "->", sLimit, "out:", d, "left:", len(src)-s, "nextemit:", nextEmit, "dstLimit:", dstLimit, "s:", s) + } + for { + candidateL := 0 + nextS := 0 + for { + // Next src position to check + nextS = s + (s-nextEmit)>>7 + 1 + if nextS > sLimit { + goto emitRemainder + } + hashL := hash7(cv, lTableBits) + hashS := hash4(cv, sTableBits) + candidateL = int(lTable[hashL]) + candidateS := int(sTable[hashS]) + lTable[hashL] = uint32(s) + sTable[hashS] = uint32(s) + + valLong := load64(src, candidateL) + valShort := load64(src, candidateS) + + // If long matches at least 8 bytes, use that. + if cv == valLong { + break + } + if cv == valShort { + candidateL = candidateS + break + } + + // Check repeat at offset checkRep. + const checkRep = 1 + // Minimum length of a repeat. Tested with various values. + // While 4-5 offers improvements in some, 6 reduces + // regressions significantly. + const wantRepeatBytes = 6 + const repeatMask = ((1 << (wantRepeatBytes * 8)) - 1) << (8 * checkRep) + if false && repeat > 0 && cv&repeatMask == load64(src, s-repeat)&repeatMask { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteral(dst[d:], src[nextEmit:base]) + + // Extend forward + candidate := s - repeat + wantRepeatBytes + checkRep + s += wantRepeatBytes + checkRep + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[candidate] { + s++ + candidate++ + continue + } + break + } + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. + d += emitRepeat(dst[d:], repeat, s-base) + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + // Index in-between + index0 := base + 1 + index1 := s - 2 + + cv = load64(src, s) + for index0 < index1 { + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint32(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 2 + index1 -= 2 + } + + cv = load64(src, s) + continue + } + + // Long likely matches 7, so take that. + if uint32(cv) == uint32(valLong) { + break + } + + // Check our short candidate + if uint32(cv) == uint32(valShort) { + // Try a long candidate at s+1 + hashL = hash7(cv>>8, lTableBits) + candidateL = int(lTable[hashL]) + lTable[hashL] = uint32(s + 1) + if uint32(cv>>8) == load32(src, candidateL) { + s++ + break + } + // Use our short candidate. + candidateL = candidateS + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards + for candidateL > 0 && s > nextEmit && src[candidateL-1] == src[s-1] { + candidateL-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + base := s + offset := base - candidateL + + // Extend the 4-byte match as long as possible. + s += 4 + candidateL += 4 + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[candidateL] { + s++ + candidateL++ + continue + } + break + } + if diff := load64(src, s) ^ load64(src, candidateL); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidateL += 8 + } + + if offset > 65535 && s-base <= 5 && repeat != offset { + // Bail if the match is equal or worse to the encoding. + s = nextS + 1 + if s >= sLimit { + goto emitRemainder + } + cv = load64(src, s) + continue + } + + d += emitLiteral(dst[d:], src[nextEmit:base]) + if repeat == offset { + d += emitRepeat(dst[d:], offset, s-base) + } else { + d += emitCopy(dst[d:], offset, s-base) + repeat = offset + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + + // Index short & long + index0 := base + 1 + index1 := s - 2 + + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint32(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint32(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // index every second long in between. + for index0 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) + lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + index0 += 2 + index1 -= 2 + } } emitRemainder: diff --git a/vendor/github.com/klauspost/compress/s2/encode_go.go b/vendor/github.com/klauspost/compress/s2/encode_go.go index 94784b82..d7749d75 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_go.go +++ b/vendor/github.com/klauspost/compress/s2/encode_go.go @@ -4,14 +4,18 @@ package s2 import ( + "bytes" "math/bits" ) +const hasAmd64Asm = false + // encodeBlock encodes a non-empty src to a guaranteed-large-enough dst. It // assumes that the varint-encoded length of the decompressed bytes has already // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) func encodeBlock(dst, src []byte) (d int) { if len(src) < minNonLiteralBlockSize { @@ -25,6 +29,7 @@ func encodeBlock(dst, src []byte) (d int) { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) func encodeBlockBetter(dst, src []byte) (d int) { return encodeBlockBetterGo(dst, src) @@ -35,6 +40,7 @@ func encodeBlockBetter(dst, src []byte) (d int) { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) func encodeBlockBetterSnappy(dst, src []byte) (d int) { return encodeBlockBetterSnappyGo(dst, src) @@ -45,6 +51,7 @@ func encodeBlockBetterSnappy(dst, src []byte) (d int) { // been written. // // It also assumes that: +// // len(dst) >= MaxEncodedLen(len(src)) func encodeBlockSnappy(dst, src []byte) (d int) { if len(src) < minNonLiteralBlockSize { @@ -56,6 +63,7 @@ func encodeBlockSnappy(dst, src []byte) (d int) { // emitLiteral writes a literal chunk and returns the number of bytes written. // // It assumes that: +// // dst is long enough to hold the encoded bytes // 0 <= len(lit) && len(lit) <= math.MaxUint32 func emitLiteral(dst, lit []byte) int { @@ -146,6 +154,7 @@ func emitRepeat(dst []byte, offset, length int) int { // emitCopy writes a copy chunk and returns the number of bytes written. // // It assumes that: +// // dst is long enough to hold the encoded bytes // 1 <= offset && offset <= math.MaxUint32 // 4 <= length && length <= 1 << 24 @@ -214,6 +223,7 @@ func emitCopy(dst []byte, offset, length int) int { // emitCopyNoRepeat writes a copy chunk and returns the number of bytes written. // // It assumes that: +// // dst is long enough to hold the encoded bytes // 1 <= offset && offset <= math.MaxUint32 // 4 <= length && length <= 1 << 24 @@ -273,8 +283,8 @@ func emitCopyNoRepeat(dst []byte, offset, length int) int { // matchLen returns how many bytes match in a and b // // It assumes that: -// len(a) <= len(b) // +// len(a) <= len(b) func matchLen(a []byte, b []byte) int { b = b[:len(a)] var checked int @@ -305,3 +315,405 @@ func matchLen(a []byte, b []byte) int { } return len(a) + checked } + +func calcBlockSize(src []byte) (d int) { + // Initialize the hash table. + const ( + tableBits = 13 + maxTableSize = 1 << tableBits + ) + + var table [maxTableSize]uint32 + + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 5 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + cv := load64(src, s) + + // We search for a repeat at -1, but don't output repeats when nextEmit == 0 + repeat := 1 + + for { + candidate := 0 + for { + // Next src position to check + nextS := s + (s-nextEmit)>>6 + 4 + if nextS > sLimit { + goto emitRemainder + } + hash0 := hash6(cv, tableBits) + hash1 := hash6(cv>>8, tableBits) + candidate = int(table[hash0]) + candidate2 := int(table[hash1]) + table[hash0] = uint32(s) + table[hash1] = uint32(s + 1) + hash2 := hash6(cv>>16, tableBits) + + // Check repeat at offset checkRep. + const checkRep = 1 + if uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteralSize(src[nextEmit:base]) + + // Extend forward + candidate := s - repeat + 4 + checkRep + s += 4 + checkRep + for s <= sLimit { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopyNoRepeatSize(repeat, s-base) + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + cv = load64(src, s) + continue + } + + if uint32(cv) == load32(src, candidate) { + break + } + candidate = int(table[hash2]) + if uint32(cv>>8) == load32(src, candidate2) { + table[hash2] = uint32(s + 2) + candidate = candidate2 + s++ + break + } + table[hash2] = uint32(s + 2) + if uint32(cv>>16) == load32(src, candidate) { + s += 2 + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards + for candidate > 0 && s > nextEmit && src[candidate-1] == src[s-1] { + candidate-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteralSize(src[nextEmit:s]) + + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = base - candidate + + // Extend the 4-byte match as long as possible. + s += 4 + candidate += 4 + for s <= len(src)-8 { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopyNoRepeatSize(repeat, s-base) + if false { + // Validate match. + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + // Check for an immediate match, otherwise start search at s+1 + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>16, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint32(s - 2) + table[currHash] = uint32(s) + if uint32(x>>16) != load32(src, candidate) { + cv = load64(src, s+1) + s++ + break + } + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteralSize(src[nextEmit:]) + } + return d +} + +func calcBlockSizeSmall(src []byte) (d int) { + // Initialize the hash table. + const ( + tableBits = 9 + maxTableSize = 1 << tableBits + ) + + var table [maxTableSize]uint32 + + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 5 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + cv := load64(src, s) + + // We search for a repeat at -1, but don't output repeats when nextEmit == 0 + repeat := 1 + + for { + candidate := 0 + for { + // Next src position to check + nextS := s + (s-nextEmit)>>6 + 4 + if nextS > sLimit { + goto emitRemainder + } + hash0 := hash6(cv, tableBits) + hash1 := hash6(cv>>8, tableBits) + candidate = int(table[hash0]) + candidate2 := int(table[hash1]) + table[hash0] = uint32(s) + table[hash1] = uint32(s + 1) + hash2 := hash6(cv>>16, tableBits) + + // Check repeat at offset checkRep. + const checkRep = 1 + if uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteralSize(src[nextEmit:base]) + + // Extend forward + candidate := s - repeat + 4 + checkRep + s += 4 + checkRep + for s <= sLimit { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopyNoRepeatSize(repeat, s-base) + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + cv = load64(src, s) + continue + } + + if uint32(cv) == load32(src, candidate) { + break + } + candidate = int(table[hash2]) + if uint32(cv>>8) == load32(src, candidate2) { + table[hash2] = uint32(s + 2) + candidate = candidate2 + s++ + break + } + table[hash2] = uint32(s + 2) + if uint32(cv>>16) == load32(src, candidate) { + s += 2 + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards + for candidate > 0 && s > nextEmit && src[candidate-1] == src[s-1] { + candidate-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteralSize(src[nextEmit:s]) + + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = base - candidate + + // Extend the 4-byte match as long as possible. + s += 4 + candidate += 4 + for s <= len(src)-8 { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopyNoRepeatSize(repeat, s-base) + if false { + // Validate match. + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + // Check for an immediate match, otherwise start search at s+1 + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>16, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint32(s - 2) + table[currHash] = uint32(s) + if uint32(x>>16) != load32(src, candidate) { + cv = load64(src, s+1) + s++ + break + } + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteralSize(src[nextEmit:]) + } + return d +} + +// emitLiteral writes a literal chunk and returns the number of bytes written. +// +// It assumes that: +// +// dst is long enough to hold the encoded bytes +// 0 <= len(lit) && len(lit) <= math.MaxUint32 +func emitLiteralSize(lit []byte) int { + if len(lit) == 0 { + return 0 + } + switch { + case len(lit) <= 60: + return len(lit) + 1 + case len(lit) <= 1<<8: + return len(lit) + 2 + case len(lit) <= 1<<16: + return len(lit) + 3 + case len(lit) <= 1<<24: + return len(lit) + 4 + default: + return len(lit) + 5 + } +} + +func cvtLZ4BlockAsm(dst []byte, src []byte) (uncompressed int, dstUsed int) { + panic("cvtLZ4BlockAsm should be unreachable") +} + +func cvtLZ4BlockSnappyAsm(dst []byte, src []byte) (uncompressed int, dstUsed int) { + panic("cvtLZ4BlockSnappyAsm should be unreachable") +} diff --git a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go index 88f27c09..9f3dc8c2 100644 --- a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go +++ b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.go @@ -1,7 +1,6 @@ // Code generated by command: go run gen.go -out ../encodeblock_amd64.s -stubs ../encodeblock_amd64.go -pkg=s2. DO NOT EDIT. //go:build !appengine && !noasm && gc && !noasm -// +build !appengine,!noasm,gc,!noasm package s2 @@ -147,11 +146,26 @@ func encodeSnappyBetterBlockAsm10B(dst []byte, src []byte) int //go:noescape func encodeSnappyBetterBlockAsm8B(dst []byte, src []byte) int +// calcBlockSize encodes a non-empty src to a guaranteed-large-enough dst. +// Maximum input 4294967295 bytes. +// It assumes that the varint-encoded length of the decompressed bytes has already been written. +// +//go:noescape +func calcBlockSize(src []byte) int + +// calcBlockSizeSmall encodes a non-empty src to a guaranteed-large-enough dst. +// Maximum input 1024 bytes. +// It assumes that the varint-encoded length of the decompressed bytes has already been written. +// +//go:noescape +func calcBlockSizeSmall(src []byte) int + // emitLiteral writes a literal chunk and returns the number of bytes written. // // It assumes that: -// dst is long enough to hold the encoded bytes with margin of 0 bytes -// 0 <= len(lit) && len(lit) <= math.MaxUint32 +// +// dst is long enough to hold the encoded bytes with margin of 0 bytes +// 0 <= len(lit) && len(lit) <= math.MaxUint32 // //go:noescape func emitLiteral(dst []byte, lit []byte) int @@ -165,9 +179,10 @@ func emitRepeat(dst []byte, offset int, length int) int // emitCopy writes a copy chunk and returns the number of bytes written. // // It assumes that: -// dst is long enough to hold the encoded bytes -// 1 <= offset && offset <= math.MaxUint32 -// 4 <= length && length <= 1 << 24 +// +// dst is long enough to hold the encoded bytes +// 1 <= offset && offset <= math.MaxUint32 +// 4 <= length && length <= 1 << 24 // //go:noescape func emitCopy(dst []byte, offset int, length int) int @@ -175,9 +190,10 @@ func emitCopy(dst []byte, offset int, length int) int // emitCopyNoRepeat writes a copy chunk and returns the number of bytes written. // // It assumes that: -// dst is long enough to hold the encoded bytes -// 1 <= offset && offset <= math.MaxUint32 -// 4 <= length && length <= 1 << 24 +// +// dst is long enough to hold the encoded bytes +// 1 <= offset && offset <= math.MaxUint32 +// 4 <= length && length <= 1 << 24 // //go:noescape func emitCopyNoRepeat(dst []byte, offset int, length int) int @@ -185,7 +201,18 @@ func emitCopyNoRepeat(dst []byte, offset int, length int) int // matchLen returns how many bytes match in a and b // // It assumes that: -// len(a) <= len(b) +// +// len(a) <= len(b) // //go:noescape func matchLen(a []byte, b []byte) int + +// cvtLZ4Block converts an LZ4 block to S2 +// +//go:noescape +func cvtLZ4BlockAsm(dst []byte, src []byte) (uncompressed int, dstUsed int) + +// cvtLZ4Block converts an LZ4 block to S2 +// +//go:noescape +func cvtLZ4BlockSnappyAsm(dst []byte, src []byte) (uncompressed int, dstUsed int) diff --git a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s index 36915d94..19bd5237 100644 --- a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s +++ b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s @@ -1,7 +1,6 @@ // Code generated by command: go run gen.go -out ../encodeblock_amd64.s -stubs ../encodeblock_amd64.go -pkg=s2. DO NOT EDIT. //go:build !appengine && !noasm && gc && !noasm -// +build !appengine,!noasm,gc,!noasm #include "textflag.h" @@ -37,8 +36,8 @@ zero_loop_encodeBlockAsm: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -48,781 +47,173 @@ zero_loop_encodeBlockAsm: MOVQ src_base+24(FP), DX search_loop_encodeBlockAsm: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x06, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x06, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBlockAsm - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 SHLQ $0x10, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x32, R10 - SHLQ $0x10, R11 - IMULQ R9, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 JNE no_repeat_found_encodeBlockAsm - LEAL 1(CX), DI - MOVL 12(SP), R8 - MOVL DI, SI - SUBL 16(SP), SI + LEAL 1(CX), SI + MOVL 12(SP), DI + MOVL SI, BX + SUBL 16(SP), BX JZ repeat_extend_back_end_encodeBlockAsm repeat_extend_back_loop_encodeBlockAsm: - CMPL DI, R8 + CMPL SI, DI JLE repeat_extend_back_end_encodeBlockAsm - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(BX*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeBlockAsm - LEAL -1(DI), DI - DECL SI + LEAL -1(SI), SI + DECL BX JNZ repeat_extend_back_loop_encodeBlockAsm repeat_extend_back_end_encodeBlockAsm: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeBlockAsm - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeBlockAsm - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeBlockAsm - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_repeat_emit_encodeBlockAsm - CMPL SI, $0x01000000 + CMPL BX, $0x01000000 JLT four_bytes_repeat_emit_encodeBlockAsm MOVB $0xfc, (AX) - MOVL SI, 1(AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP memmove_long_repeat_emit_encodeBlockAsm four_bytes_repeat_emit_encodeBlockAsm: - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_repeat_emit_encodeBlockAsm three_bytes_repeat_emit_encodeBlockAsm: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeBlockAsm two_bytes_repeat_emit_encodeBlockAsm: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeBlockAsm JMP memmove_long_repeat_emit_encodeBlockAsm one_byte_repeat_emit_encodeBlockAsm: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_repeat_emit_encodeBlockAsm emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm emit_lit_memmove_repeat_emit_encodeBlockAsm_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_repeat_emit_encodeBlockAsm: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeBlockAsm memmove_long_repeat_emit_encodeBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R12 - SHRQ $0x05, R12 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R13 - SUBQ R11, R13 - DECQ R12 - JA emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(R10)(R13*1), R11 - LEAQ -32(AX)(R13*1), R14 - -emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R14) - MOVOA X5, 16(R14) - ADDQ $0x20, R14 - ADDQ $0x20, R11 - ADDQ $0x20, R13 - DECQ R12 - JNA emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_big_loop_back - -emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(R10)(R13*1), X4 - MOVOU -16(R10)(R13*1), X5 - MOVOA X4, -32(AX)(R13*1) - MOVOA X5, -16(AX)(R13*1) - ADDQ $0x20, R13 - CMPQ R9, R13 - JAE emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX - -emit_literal_done_repeat_emit_encodeBlockAsm: - ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R9 - SUBL CX, R9 - LEAQ (DX)(CX*1), R10 - LEAQ (DX)(SI*1), SI - - // matchLen - XORL R12, R12 - CMPL R9, $0x08 - JL matchlen_match4_repeat_extend_encodeBlockAsm - -matchlen_loopback_repeat_extend_encodeBlockAsm: - MOVQ (R10)(R12*1), R11 - XORQ (SI)(R12*1), R11 - TESTQ R11, R11 - JZ matchlen_loop_repeat_extend_encodeBlockAsm - -#ifdef GOAMD64_v3 - TZCNTQ R11, R11 - -#else - BSFQ R11, R11 - -#endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 - JMP repeat_extend_forward_end_encodeBlockAsm - -matchlen_loop_repeat_extend_encodeBlockAsm: - LEAL -8(R9), R9 - LEAL 8(R12), R12 - CMPL R9, $0x08 - JGE matchlen_loopback_repeat_extend_encodeBlockAsm - JZ repeat_extend_forward_end_encodeBlockAsm - -matchlen_match4_repeat_extend_encodeBlockAsm: - CMPL R9, $0x04 - JL matchlen_match2_repeat_extend_encodeBlockAsm - MOVL (R10)(R12*1), R11 - CMPL (SI)(R12*1), R11 - JNE matchlen_match2_repeat_extend_encodeBlockAsm - SUBL $0x04, R9 - LEAL 4(R12), R12 - -matchlen_match2_repeat_extend_encodeBlockAsm: - CMPL R9, $0x02 - JL matchlen_match1_repeat_extend_encodeBlockAsm - MOVW (R10)(R12*1), R11 - CMPW (SI)(R12*1), R11 - JNE matchlen_match1_repeat_extend_encodeBlockAsm - SUBL $0x02, R9 - LEAL 2(R12), R12 - -matchlen_match1_repeat_extend_encodeBlockAsm: - CMPL R9, $0x01 - JL repeat_extend_forward_end_encodeBlockAsm - MOVB (R10)(R12*1), R11 - CMPB (SI)(R12*1), R11 - JNE repeat_extend_forward_end_encodeBlockAsm - LEAL 1(R12), R12 - -repeat_extend_forward_end_encodeBlockAsm: - ADDL R12, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - TESTL R8, R8 - JZ repeat_as_copy_encodeBlockAsm - - // emitRepeat -emit_repeat_again_match_repeat_encodeBlockAsm: - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 - JLE repeat_two_match_repeat_encodeBlockAsm - CMPL R8, $0x0c - JGE cant_repeat_two_offset_match_repeat_encodeBlockAsm - CMPL DI, $0x00000800 - JLT repeat_two_offset_match_repeat_encodeBlockAsm - -cant_repeat_two_offset_match_repeat_encodeBlockAsm: - CMPL SI, $0x00000104 - JLT repeat_three_match_repeat_encodeBlockAsm - CMPL SI, $0x00010100 - JLT repeat_four_match_repeat_encodeBlockAsm - CMPL SI, $0x0100ffff - JLT repeat_five_match_repeat_encodeBlockAsm - LEAL -16842747(SI), SI - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) - MOVB $0xff, 4(AX) - ADDQ $0x05, AX - JMP emit_repeat_again_match_repeat_encodeBlockAsm - -repeat_five_match_repeat_encodeBlockAsm: - LEAL -65536(SI), SI - MOVL SI, DI - MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) - ADDQ $0x05, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_four_match_repeat_encodeBlockAsm: - LEAL -256(SI), SI - MOVW $0x0019, (AX) - MOVW SI, 2(AX) - ADDQ $0x04, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_three_match_repeat_encodeBlockAsm: - LEAL -4(SI), SI - MOVW $0x0015, (AX) - MOVB SI, 2(AX) - ADDQ $0x03, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_match_repeat_encodeBlockAsm: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_offset_match_repeat_encodeBlockAsm: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_as_copy_encodeBlockAsm: - // emitCopy - CMPL DI, $0x00010000 - JL two_byte_offset_repeat_as_copy_encodeBlockAsm - -four_bytes_loop_back_repeat_as_copy_encodeBlockAsm: - CMPL SI, $0x40 - JLE four_bytes_remain_repeat_as_copy_encodeBlockAsm - MOVB $0xff, (AX) - MOVL DI, 1(AX) - LEAL -64(SI), SI - ADDQ $0x05, AX - CMPL SI, $0x04 - JL four_bytes_remain_repeat_as_copy_encodeBlockAsm - - // emitRepeat -emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy: - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 - JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy - CMPL R8, $0x0c - JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy - CMPL DI, $0x00000800 - JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy - -cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy: - CMPL SI, $0x00000104 - JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy - CMPL SI, $0x00010100 - JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy - CMPL SI, $0x0100ffff - JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy - LEAL -16842747(SI), SI - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) - MOVB $0xff, 4(AX) - ADDQ $0x05, AX - JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy - -repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy: - LEAL -65536(SI), SI - MOVL SI, DI - MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) - ADDQ $0x05, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy: - LEAL -256(SI), SI - MOVW $0x0019, (AX) - MOVW SI, 2(AX) - ADDQ $0x04, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy: - LEAL -4(SI), SI - MOVW $0x0015, (AX) - MOVB SI, 2(AX) - ADDQ $0x03, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - JMP four_bytes_loop_back_repeat_as_copy_encodeBlockAsm - -four_bytes_remain_repeat_as_copy_encodeBlockAsm: - TESTL SI, SI - JZ repeat_end_emit_encodeBlockAsm - MOVB $0x03, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVL DI, 1(AX) - ADDQ $0x05, AX - JMP repeat_end_emit_encodeBlockAsm - -two_byte_offset_repeat_as_copy_encodeBlockAsm: - CMPL SI, $0x40 - JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm - CMPL DI, $0x00000800 - JAE long_offset_short_repeat_as_copy_encodeBlockAsm - MOVL $0x00000001, R8 - LEAL 16(R8), R8 - MOVB DI, 1(AX) - MOVL DI, R9 - SHRL $0x08, R9 - SHLL $0x05, R9 - ORL R9, R8 - MOVB R8, (AX) - ADDQ $0x02, AX - SUBL $0x08, SI - - // emitRepeat - LEAL -4(SI), SI - JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - -emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 - JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - CMPL R8, $0x0c - JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - CMPL DI, $0x00000800 - JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - -cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - CMPL SI, $0x00000104 - JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - CMPL SI, $0x00010100 - JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - CMPL SI, $0x0100ffff - JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - LEAL -16842747(SI), SI - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) - MOVB $0xff, 4(AX) - ADDQ $0x05, AX - JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b - -repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - LEAL -65536(SI), SI - MOVL SI, DI - MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) - ADDQ $0x05, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - LEAL -256(SI), SI - MOVW $0x0019, (AX) - MOVW SI, 2(AX) - ADDQ $0x04, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - LEAL -4(SI), SI - MOVW $0x0015, (AX) - MOVB SI, 2(AX) - ADDQ $0x03, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -long_offset_short_repeat_as_copy_encodeBlockAsm: - MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI - ADDQ $0x03, AX - - // emitRepeat -emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short: - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 - JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short - CMPL R8, $0x0c - JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short - CMPL DI, $0x00000800 - JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short - -cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short: - CMPL SI, $0x00000104 - JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short - CMPL SI, $0x00010100 - JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short - CMPL SI, $0x0100ffff - JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short - LEAL -16842747(SI), SI - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) - MOVB $0xff, 4(AX) - ADDQ $0x05, AX - JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short - -repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short: - LEAL -65536(SI), SI - MOVL SI, DI - MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) - ADDQ $0x05, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short: - LEAL -256(SI), SI - MOVW $0x0019, (AX) - MOVW SI, 2(AX) - ADDQ $0x04, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short: - LEAL -4(SI), SI - MOVW $0x0015, (AX) - MOVB SI, 2(AX) - ADDQ $0x03, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - JMP two_byte_offset_repeat_as_copy_encodeBlockAsm - -two_byte_offset_short_repeat_as_copy_encodeBlockAsm: - CMPL SI, $0x0c - JGE emit_copy_three_repeat_as_copy_encodeBlockAsm - CMPL DI, $0x00000800 - JGE emit_copy_three_repeat_as_copy_encodeBlockAsm - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeBlockAsm - -emit_copy_three_repeat_as_copy_encodeBlockAsm: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) - ADDQ $0x03, AX - -repeat_end_emit_encodeBlockAsm: - MOVL CX, 12(SP) - JMP search_loop_encodeBlockAsm - -no_repeat_found_encodeBlockAsm: - CMPL (DX)(SI*1), DI - JEQ candidate_match_encodeBlockAsm - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI - JEQ candidate2_match_encodeBlockAsm - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI - JEQ candidate3_match_encodeBlockAsm - MOVL 20(SP), CX - JMP search_loop_encodeBlockAsm - -candidate3_match_encodeBlockAsm: - ADDL $0x02, CX - JMP candidate_match_encodeBlockAsm - -candidate2_match_encodeBlockAsm: - MOVL R9, 24(SP)(R10*4) - INCL CX - MOVL R8, SI - -candidate_match_encodeBlockAsm: - MOVL 12(SP), DI - TESTL SI, SI - JZ match_extend_back_end_encodeBlockAsm - -match_extend_back_loop_encodeBlockAsm: - CMPL CX, DI - JLE match_extend_back_end_encodeBlockAsm - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 - JNE match_extend_back_end_encodeBlockAsm - LEAL -1(CX), CX - DECL SI - JZ match_extend_back_end_encodeBlockAsm - JMP match_extend_back_loop_encodeBlockAsm - -match_extend_back_end_encodeBlockAsm: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 5(AX)(DI*1), DI - CMPQ DI, (SP) - JL match_dst_size_check_encodeBlockAsm - MOVQ $0x00000000, ret+48(FP) - RET - -match_dst_size_check_encodeBlockAsm: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI - JEQ emit_literal_done_match_emit_encodeBlockAsm - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c - JLT one_byte_match_emit_encodeBlockAsm - CMPL R8, $0x00000100 - JLT two_bytes_match_emit_encodeBlockAsm - CMPL R8, $0x00010000 - JLT three_bytes_match_emit_encodeBlockAsm - CMPL R8, $0x01000000 - JLT four_bytes_match_emit_encodeBlockAsm - MOVB $0xfc, (AX) - MOVL R8, 1(AX) - ADDQ $0x05, AX - JMP memmove_long_match_emit_encodeBlockAsm - -four_bytes_match_emit_encodeBlockAsm: - MOVL R8, R10 - SHRL $0x10, R10 - MOVB $0xf8, (AX) - MOVW R8, 1(AX) - MOVB R10, 3(AX) - ADDQ $0x04, AX - JMP memmove_long_match_emit_encodeBlockAsm - -three_bytes_match_emit_encodeBlockAsm: - MOVB $0xf4, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_encodeBlockAsm - -two_bytes_match_emit_encodeBlockAsm: - MOVB $0xf0, (AX) - MOVB R8, 1(AX) - ADDQ $0x02, AX - CMPL R8, $0x40 - JL memmove_match_emit_encodeBlockAsm - JMP memmove_long_match_emit_encodeBlockAsm - -one_byte_match_emit_encodeBlockAsm: - SHLB $0x02, R8 - MOVB R8, (AX) - ADDQ $0x01, AX - -memmove_match_emit_encodeBlockAsm: - LEAQ (AX)(R9*1), R8 - - // genMemMoveShort - CMPQ R9, $0x08 - JLE emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8 - CMPQ R9, $0x10 - JBE emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8through16 - CMPQ R9, $0x20 - JBE emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_33through64 - -emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) - JMP memmove_end_copy_match_emit_encodeBlockAsm - -emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeBlockAsm - -emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeBlockAsm - -emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeBlockAsm: - MOVQ R8, AX - JMP emit_literal_done_match_emit_encodeBlockAsm - -memmove_long_match_emit_encodeBlockAsm: - LEAQ (AX)(R9*1), R8 - - // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R11 SHRQ $0x05, R11 MOVQ AX, R10 ANDL $0x0000001f, R10 MOVQ $0x00000040, R12 SUBQ R10, R12 DECQ R11 - JA emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 + JA emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_forward_sse_loop_32 + LEAQ -32(R9)(R12*1), R10 LEAQ -32(AX)(R12*1), R13 -emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_big_loop_back: +emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_big_loop_back: MOVOU (R10), X4 MOVOU 16(R10), X5 MOVOA X4, (R13) @@ -831,192 +222,254 @@ emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_big_loop_back: ADDQ $0x20, R10 ADDQ $0x20, R12 DECQ R11 - JNA emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_big_loop_back + JNA emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_big_loop_back -emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 +emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_forward_sse_loop_32: + MOVOU -32(R9)(R12*1), X4 + MOVOU -16(R9)(R12*1), X5 MOVOA X4, -32(AX)(R12*1) MOVOA X5, -16(AX)(R12*1) ADDQ $0x20, R12 - CMPQ R9, R12 - JAE emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_forward_sse_loop_32 + CMPQ R8, R12 + JAE emit_lit_memmove_long_repeat_emit_encodeBlockAsmlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX -emit_literal_done_match_emit_encodeBlockAsm: -match_nolit_loop_encodeBlockAsm: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) - ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), DI - SUBL CX, DI - LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI +emit_literal_done_repeat_emit_encodeBlockAsm: + ADDL $0x05, CX + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+32(FP), R8 + SUBL CX, R8 + LEAQ (DX)(CX*1), R9 + LEAQ (DX)(BX*1), BX // matchLen - XORL R10, R10 - CMPL DI, $0x08 - JL matchlen_match4_match_nolit_encodeBlockAsm + XORL R11, R11 + CMPL R8, $0x08 + JL matchlen_match4_repeat_extend_encodeBlockAsm -matchlen_loopback_match_nolit_encodeBlockAsm: - MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 - TESTQ R9, R9 - JZ matchlen_loop_match_nolit_encodeBlockAsm +matchlen_loopback_repeat_extend_encodeBlockAsm: + MOVQ (R9)(R11*1), R10 + XORQ (BX)(R11*1), R10 + TESTQ R10, R10 + JZ matchlen_loop_repeat_extend_encodeBlockAsm #ifdef GOAMD64_v3 - TZCNTQ R9, R9 + TZCNTQ R10, R10 #else - BSFQ R9, R9 + BSFQ R10, R10 #endif - SARQ $0x03, R9 - LEAL (R10)(R9*1), R10 - JMP match_nolit_end_encodeBlockAsm + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 + JMP repeat_extend_forward_end_encodeBlockAsm -matchlen_loop_match_nolit_encodeBlockAsm: - LEAL -8(DI), DI - LEAL 8(R10), R10 - CMPL DI, $0x08 - JGE matchlen_loopback_match_nolit_encodeBlockAsm - JZ match_nolit_end_encodeBlockAsm +matchlen_loop_repeat_extend_encodeBlockAsm: + LEAL -8(R8), R8 + LEAL 8(R11), R11 + CMPL R8, $0x08 + JGE matchlen_loopback_repeat_extend_encodeBlockAsm + JZ repeat_extend_forward_end_encodeBlockAsm -matchlen_match4_match_nolit_encodeBlockAsm: - CMPL DI, $0x04 - JL matchlen_match2_match_nolit_encodeBlockAsm - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 - JNE matchlen_match2_match_nolit_encodeBlockAsm - SUBL $0x04, DI - LEAL 4(R10), R10 +matchlen_match4_repeat_extend_encodeBlockAsm: + CMPL R8, $0x04 + JL matchlen_match2_repeat_extend_encodeBlockAsm + MOVL (R9)(R11*1), R10 + CMPL (BX)(R11*1), R10 + JNE matchlen_match2_repeat_extend_encodeBlockAsm + SUBL $0x04, R8 + LEAL 4(R11), R11 -matchlen_match2_match_nolit_encodeBlockAsm: - CMPL DI, $0x02 - JL matchlen_match1_match_nolit_encodeBlockAsm - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 - JNE matchlen_match1_match_nolit_encodeBlockAsm - SUBL $0x02, DI - LEAL 2(R10), R10 +matchlen_match2_repeat_extend_encodeBlockAsm: + CMPL R8, $0x02 + JL matchlen_match1_repeat_extend_encodeBlockAsm + MOVW (R9)(R11*1), R10 + CMPW (BX)(R11*1), R10 + JNE matchlen_match1_repeat_extend_encodeBlockAsm + SUBL $0x02, R8 + LEAL 2(R11), R11 -matchlen_match1_match_nolit_encodeBlockAsm: - CMPL DI, $0x01 - JL match_nolit_end_encodeBlockAsm - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 - JNE match_nolit_end_encodeBlockAsm - LEAL 1(R10), R10 +matchlen_match1_repeat_extend_encodeBlockAsm: + CMPL R8, $0x01 + JL repeat_extend_forward_end_encodeBlockAsm + MOVB (R9)(R11*1), R10 + CMPB (BX)(R11*1), R10 + JNE repeat_extend_forward_end_encodeBlockAsm + LEAL 1(R11), R11 -match_nolit_end_encodeBlockAsm: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 - MOVL CX, 12(SP) - - // emitCopy - CMPL SI, $0x00010000 - JL two_byte_offset_match_nolit_encodeBlockAsm - -four_bytes_loop_back_match_nolit_encodeBlockAsm: - CMPL R10, $0x40 - JLE four_bytes_remain_match_nolit_encodeBlockAsm - MOVB $0xff, (AX) - MOVL SI, 1(AX) - LEAL -64(R10), R10 - ADDQ $0x05, AX - CMPL R10, $0x04 - JL four_bytes_remain_match_nolit_encodeBlockAsm +repeat_extend_forward_end_encodeBlockAsm: + ADDL R11, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + TESTL DI, DI + JZ repeat_as_copy_encodeBlockAsm // emitRepeat -emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy: - MOVL R10, DI - LEAL -4(R10), R10 +emit_repeat_again_match_repeat_encodeBlockAsm: + MOVL BX, DI + LEAL -4(BX), BX CMPL DI, $0x08 - JLE repeat_two_match_nolit_encodeBlockAsm_emit_copy + JLE repeat_two_match_repeat_encodeBlockAsm CMPL DI, $0x0c - JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy + JGE cant_repeat_two_offset_match_repeat_encodeBlockAsm CMPL SI, $0x00000800 - JLT repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy + JLT repeat_two_offset_match_repeat_encodeBlockAsm -cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy: - CMPL R10, $0x00000104 - JLT repeat_three_match_nolit_encodeBlockAsm_emit_copy - CMPL R10, $0x00010100 - JLT repeat_four_match_nolit_encodeBlockAsm_emit_copy - CMPL R10, $0x0100ffff - JLT repeat_five_match_nolit_encodeBlockAsm_emit_copy - LEAL -16842747(R10), R10 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) +cant_repeat_two_offset_match_repeat_encodeBlockAsm: + CMPL BX, $0x00000104 + JLT repeat_three_match_repeat_encodeBlockAsm + CMPL BX, $0x00010100 + JLT repeat_four_match_repeat_encodeBlockAsm + CMPL BX, $0x0100ffff + JLT repeat_five_match_repeat_encodeBlockAsm + LEAL -16842747(BX), BX + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX - JMP emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy + JMP emit_repeat_again_match_repeat_encodeBlockAsm -repeat_five_match_nolit_encodeBlockAsm_emit_copy: - LEAL -65536(R10), R10 - MOVL R10, SI +repeat_five_match_repeat_encodeBlockAsm: + LEAL -65536(BX), BX + MOVL BX, SI MOVW $0x001d, (AX) - MOVW R10, 2(AX) + MOVW BX, 2(AX) SARL $0x10, SI MOVB SI, 4(AX) ADDQ $0x05, AX - JMP match_nolit_emitcopy_end_encodeBlockAsm + JMP repeat_end_emit_encodeBlockAsm -repeat_four_match_nolit_encodeBlockAsm_emit_copy: - LEAL -256(R10), R10 +repeat_four_match_repeat_encodeBlockAsm: + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX - JMP match_nolit_emitcopy_end_encodeBlockAsm + JMP repeat_end_emit_encodeBlockAsm -repeat_three_match_nolit_encodeBlockAsm_emit_copy: - LEAL -4(R10), R10 +repeat_three_match_repeat_encodeBlockAsm: + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX - JMP match_nolit_emitcopy_end_encodeBlockAsm + JMP repeat_end_emit_encodeBlockAsm -repeat_two_match_nolit_encodeBlockAsm_emit_copy: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) +repeat_two_match_repeat_encodeBlockAsm: + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBlockAsm + JMP repeat_end_emit_encodeBlockAsm -repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy: +repeat_two_offset_match_repeat_encodeBlockAsm: XORQ DI, DI - LEAL 1(DI)(R10*4), R10 + LEAL 1(DI)(BX*4), BX MOVB SI, 1(AX) SARL $0x08, SI SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBlockAsm - JMP four_bytes_loop_back_match_nolit_encodeBlockAsm + JMP repeat_end_emit_encodeBlockAsm -four_bytes_remain_match_nolit_encodeBlockAsm: - TESTL R10, R10 - JZ match_nolit_emitcopy_end_encodeBlockAsm - MOVB $0x03, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) +repeat_as_copy_encodeBlockAsm: + // emitCopy + CMPL SI, $0x00010000 + JL two_byte_offset_repeat_as_copy_encodeBlockAsm + CMPL BX, $0x40 + JLE four_bytes_remain_repeat_as_copy_encodeBlockAsm + MOVB $0xff, (AX) + MOVL SI, 1(AX) + LEAL -64(BX), BX + ADDQ $0x05, AX + CMPL BX, $0x04 + JL four_bytes_remain_repeat_as_copy_encodeBlockAsm + + // emitRepeat +emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy: + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy + CMPL DI, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy + CMPL SI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy: + CMPL BX, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy + CMPL BX, $0x00010100 + JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy + CMPL BX, $0x0100ffff + JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy + LEAL -16842747(BX), BX + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy + +repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy: + LEAL -65536(BX), BX + MOVL BX, SI + MOVW $0x001d, (AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) + ADDQ $0x05, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy: + LEAL -256(BX), BX + MOVW $0x0019, (AX) + MOVW BX, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy: + LEAL -4(BX), BX + MOVW $0x0015, (AX) + MOVB BL, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy: + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy: + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +four_bytes_remain_repeat_as_copy_encodeBlockAsm: + TESTL BX, BX + JZ repeat_end_emit_encodeBlockAsm + XORL DI, DI + LEAL -1(DI)(BX*4), BX + MOVB BL, (AX) MOVL SI, 1(AX) ADDQ $0x05, AX - JMP match_nolit_emitcopy_end_encodeBlockAsm + JMP repeat_end_emit_encodeBlockAsm -two_byte_offset_match_nolit_encodeBlockAsm: - CMPL R10, $0x40 - JLE two_byte_offset_short_match_nolit_encodeBlockAsm +two_byte_offset_repeat_as_copy_encodeBlockAsm: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm CMPL SI, $0x00000800 - JAE long_offset_short_match_nolit_encodeBlockAsm + JAE long_offset_short_repeat_as_copy_encodeBlockAsm MOVL $0x00000001, DI LEAL 16(DI), DI MOVB SI, 1(AX) @@ -1026,200 +479,731 @@ two_byte_offset_match_nolit_encodeBlockAsm: ORL R8, DI MOVB DI, (AX) ADDQ $0x02, AX - SUBL $0x08, R10 + SUBL $0x08, BX // emitRepeat - LEAL -4(R10), R10 + LEAL -4(BX), BX + JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + +emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL DI, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL SI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + CMPL BX, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL BX, $0x00010100 + JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + CMPL BX, $0x0100ffff + JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + LEAL -16842747(BX), BX + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b + +repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + LEAL -65536(BX), BX + MOVL BX, SI + MOVW $0x001d, (AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) + ADDQ $0x05, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + LEAL -256(BX), BX + MOVW $0x0019, (AX) + MOVW BX, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + LEAL -4(BX), BX + MOVW $0x0015, (AX) + MOVB BL, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short_2b: + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +long_offset_short_repeat_as_copy_encodeBlockAsm: + MOVB $0xee, (AX) + MOVW SI, 1(AX) + LEAL -60(BX), BX + ADDQ $0x03, AX + + // emitRepeat +emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short: + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 + JLE repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short + CMPL DI, $0x0c + JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short + CMPL SI, $0x00000800 + JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short + +cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short: + CMPL BX, $0x00000104 + JLT repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short + CMPL BX, $0x00010100 + JLT repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short + CMPL BX, $0x0100ffff + JLT repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short + LEAL -16842747(BX), BX + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_repeat_as_copy_encodeBlockAsm_emit_copy_short + +repeat_five_repeat_as_copy_encodeBlockAsm_emit_copy_short: + LEAL -65536(BX), BX + MOVL BX, SI + MOVW $0x001d, (AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) + ADDQ $0x05, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_four_repeat_as_copy_encodeBlockAsm_emit_copy_short: + LEAL -256(BX), BX + MOVW $0x0019, (AX) + MOVW BX, 2(AX) + ADDQ $0x04, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_three_repeat_as_copy_encodeBlockAsm_emit_copy_short: + LEAL -4(BX), BX + MOVW $0x0015, (AX) + MOVB BL, 2(AX) + ADDQ $0x03, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_repeat_as_copy_encodeBlockAsm_emit_copy_short: + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +repeat_two_offset_repeat_as_copy_encodeBlockAsm_emit_copy_short: + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +two_byte_offset_short_repeat_as_copy_encodeBlockAsm: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_encodeBlockAsm + CMPL SI, $0x00000800 + JGE emit_copy_three_repeat_as_copy_encodeBlockAsm + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeBlockAsm + +emit_copy_three_repeat_as_copy_encodeBlockAsm: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) + ADDQ $0x03, AX + +repeat_end_emit_encodeBlockAsm: + MOVL CX, 12(SP) + JMP search_loop_encodeBlockAsm + +no_repeat_found_encodeBlockAsm: + CMPL (DX)(BX*1), SI + JEQ candidate_match_encodeBlockAsm + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_encodeBlockAsm + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_encodeBlockAsm + MOVL 20(SP), CX + JMP search_loop_encodeBlockAsm + +candidate3_match_encodeBlockAsm: + ADDL $0x02, CX + JMP candidate_match_encodeBlockAsm + +candidate2_match_encodeBlockAsm: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_encodeBlockAsm: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_encodeBlockAsm + +match_extend_back_loop_encodeBlockAsm: + CMPL CX, SI + JLE match_extend_back_end_encodeBlockAsm + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_encodeBlockAsm + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_encodeBlockAsm + JMP match_extend_back_loop_encodeBlockAsm + +match_extend_back_end_encodeBlockAsm: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 5(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_encodeBlockAsm + MOVQ $0x00000000, ret+48(FP) + RET + +match_dst_size_check_encodeBlockAsm: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_encodeBlockAsm + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c + JLT one_byte_match_emit_encodeBlockAsm + CMPL DI, $0x00000100 + JLT two_bytes_match_emit_encodeBlockAsm + CMPL DI, $0x00010000 + JLT three_bytes_match_emit_encodeBlockAsm + CMPL DI, $0x01000000 + JLT four_bytes_match_emit_encodeBlockAsm + MOVB $0xfc, (AX) + MOVL DI, 1(AX) + ADDQ $0x05, AX + JMP memmove_long_match_emit_encodeBlockAsm + +four_bytes_match_emit_encodeBlockAsm: + MOVL DI, R9 + SHRL $0x10, R9 + MOVB $0xf8, (AX) + MOVW DI, 1(AX) + MOVB R9, 3(AX) + ADDQ $0x04, AX + JMP memmove_long_match_emit_encodeBlockAsm + +three_bytes_match_emit_encodeBlockAsm: + MOVB $0xf4, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_encodeBlockAsm + +two_bytes_match_emit_encodeBlockAsm: + MOVB $0xf0, (AX) + MOVB DI, 1(AX) + ADDQ $0x02, AX + CMPL DI, $0x40 + JL memmove_match_emit_encodeBlockAsm + JMP memmove_long_match_emit_encodeBlockAsm + +one_byte_match_emit_encodeBlockAsm: + SHLB $0x02, DI + MOVB DI, (AX) + ADDQ $0x01, AX + +memmove_match_emit_encodeBlockAsm: + LEAQ (AX)(R8*1), DI + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_33through64 + +emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8: + MOVQ (SI), R9 + MOVQ R9, (AX) + JMP memmove_end_copy_match_emit_encodeBlockAsm + +emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_8through16: + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeBlockAsm + +emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_17through32: + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeBlockAsm + +emit_lit_memmove_match_emit_encodeBlockAsm_memmove_move_33through64: + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_match_emit_encodeBlockAsm: + MOVQ DI, AX + JMP emit_literal_done_match_emit_encodeBlockAsm + +memmove_long_match_emit_encodeBlockAsm: + LEAQ (AX)(R8*1), DI + + // genMemMoveLong + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 + JA emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_forward_sse_loop_32 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 + +emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) + ADDQ $0x20, R12 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_big_loop_back + +emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_forward_sse_loop_32: + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 + JAE emit_lit_memmove_long_match_emit_encodeBlockAsmlarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX + +emit_literal_done_match_emit_encodeBlockAsm: +match_nolit_loop_encodeBlockAsm: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_encodeBlockAsm + +matchlen_loopback_match_nolit_encodeBlockAsm: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_encodeBlockAsm + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_encodeBlockAsm + +matchlen_loop_match_nolit_encodeBlockAsm: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 + JGE matchlen_loopback_match_nolit_encodeBlockAsm + JZ match_nolit_end_encodeBlockAsm + +matchlen_match4_match_nolit_encodeBlockAsm: + CMPL SI, $0x04 + JL matchlen_match2_match_nolit_encodeBlockAsm + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 + JNE matchlen_match2_match_nolit_encodeBlockAsm + SUBL $0x04, SI + LEAL 4(R9), R9 + +matchlen_match2_match_nolit_encodeBlockAsm: + CMPL SI, $0x02 + JL matchlen_match1_match_nolit_encodeBlockAsm + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 + JNE matchlen_match1_match_nolit_encodeBlockAsm + SUBL $0x02, SI + LEAL 2(R9), R9 + +matchlen_match1_match_nolit_encodeBlockAsm: + CMPL SI, $0x01 + JL match_nolit_end_encodeBlockAsm + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 + JNE match_nolit_end_encodeBlockAsm + LEAL 1(R9), R9 + +match_nolit_end_encodeBlockAsm: + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 + MOVL CX, 12(SP) + + // emitCopy + CMPL BX, $0x00010000 + JL two_byte_offset_match_nolit_encodeBlockAsm + CMPL R9, $0x40 + JLE four_bytes_remain_match_nolit_encodeBlockAsm + MOVB $0xff, (AX) + MOVL BX, 1(AX) + LEAL -64(R9), R9 + ADDQ $0x05, AX + CMPL R9, $0x04 + JL four_bytes_remain_match_nolit_encodeBlockAsm + + // emitRepeat +emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy: + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 + JLE repeat_two_match_nolit_encodeBlockAsm_emit_copy + CMPL SI, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy + CMPL BX, $0x00000800 + JLT repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy + +cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy: + CMPL R9, $0x00000104 + JLT repeat_three_match_nolit_encodeBlockAsm_emit_copy + CMPL R9, $0x00010100 + JLT repeat_four_match_nolit_encodeBlockAsm_emit_copy + CMPL R9, $0x0100ffff + JLT repeat_five_match_nolit_encodeBlockAsm_emit_copy + LEAL -16842747(R9), R9 + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy + +repeat_five_match_nolit_encodeBlockAsm_emit_copy: + LEAL -65536(R9), R9 + MOVL R9, BX + MOVW $0x001d, (AX) + MOVW R9, 2(AX) + SARL $0x10, BX + MOVB BL, 4(AX) + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_four_match_nolit_encodeBlockAsm_emit_copy: + LEAL -256(R9), R9 + MOVW $0x0019, (AX) + MOVW R9, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_three_match_nolit_encodeBlockAsm_emit_copy: + LEAL -4(R9), R9 + MOVW $0x0015, (AX) + MOVB R9, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_two_match_nolit_encodeBlockAsm_emit_copy: + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy: + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +four_bytes_remain_match_nolit_encodeBlockAsm: + TESTL R9, R9 + JZ match_nolit_emitcopy_end_encodeBlockAsm + XORL SI, SI + LEAL -1(SI)(R9*4), R9 + MOVB R9, (AX) + MOVL BX, 1(AX) + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_encodeBlockAsm + +two_byte_offset_match_nolit_encodeBlockAsm: + CMPL R9, $0x40 + JLE two_byte_offset_short_match_nolit_encodeBlockAsm + CMPL BX, $0x00000800 + JAE long_offset_short_match_nolit_encodeBlockAsm + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB BL, 1(AX) + MOVL BX, DI + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, SI + MOVB SI, (AX) + ADDQ $0x02, AX + SUBL $0x08, R9 + + // emitRepeat + LEAL -4(R9), R9 JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy_short_2b: - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm_emit_copy_short_2b - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm_emit_copy_short_2b - CMPL R10, $0x00010100 + CMPL R9, $0x00010100 JLT repeat_four_match_nolit_encodeBlockAsm_emit_copy_short_2b - CMPL R10, $0x0100ffff + CMPL R9, $0x0100ffff JLT repeat_five_match_nolit_encodeBlockAsm_emit_copy_short_2b - LEAL -16842747(R10), R10 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + LEAL -16842747(R9), R9 + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX JMP emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy_short_2b repeat_five_match_nolit_encodeBlockAsm_emit_copy_short_2b: - LEAL -65536(R10), R10 - MOVL R10, SI + LEAL -65536(R9), R9 + MOVL R9, BX MOVW $0x001d, (AX) - MOVW R10, 2(AX) - SARL $0x10, SI - MOVB SI, 4(AX) + MOVW R9, 2(AX) + SARL $0x10, BX + MOVB BL, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_four_match_nolit_encodeBlockAsm_emit_copy_short_2b: - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_three_match_nolit_encodeBlockAsm_emit_copy_short_2b: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_two_match_nolit_encodeBlockAsm_emit_copy_short_2b: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short_2b: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm long_offset_short_match_nolit_encodeBlockAsm: MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX // emitRepeat emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy_short: - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm_emit_copy_short - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm_emit_copy_short - CMPL R10, $0x00010100 + CMPL R9, $0x00010100 JLT repeat_four_match_nolit_encodeBlockAsm_emit_copy_short - CMPL R10, $0x0100ffff + CMPL R9, $0x0100ffff JLT repeat_five_match_nolit_encodeBlockAsm_emit_copy_short - LEAL -16842747(R10), R10 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + LEAL -16842747(R9), R9 + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX JMP emit_repeat_again_match_nolit_encodeBlockAsm_emit_copy_short repeat_five_match_nolit_encodeBlockAsm_emit_copy_short: - LEAL -65536(R10), R10 - MOVL R10, SI + LEAL -65536(R9), R9 + MOVL R9, BX MOVW $0x001d, (AX) - MOVW R10, 2(AX) - SARL $0x10, SI - MOVB SI, 4(AX) + MOVW R9, 2(AX) + SARL $0x10, BX + MOVB BL, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_four_match_nolit_encodeBlockAsm_emit_copy_short: - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_three_match_nolit_encodeBlockAsm_emit_copy_short: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_two_match_nolit_encodeBlockAsm_emit_copy_short: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm repeat_two_offset_match_nolit_encodeBlockAsm_emit_copy_short: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm - JMP two_byte_offset_match_nolit_encodeBlockAsm two_byte_offset_short_match_nolit_encodeBlockAsm: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeBlockAsm - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeBlockAsm - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm emit_copy_three_match_nolit_encodeBlockAsm: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeBlockAsm: CMPL CX, 8(SP) JGE emit_remainder_encodeBlockAsm - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeBlockAsm MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeBlockAsm: - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x10, R8 - IMULQ R9, R8 - SHRQ $0x32, R8 - SHLQ $0x10, SI - IMULQ R9, SI - SHRQ $0x32, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x10, DI + IMULQ R8, DI + SHRQ $0x32, DI + SHLQ $0x10, BX + IMULQ R8, BX + SHRQ $0x32, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeBlockAsm INCL CX JMP search_loop_encodeBlockAsm @@ -1423,8 +1407,8 @@ zero_loop_encodeBlockAsm4MB: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -1434,555 +1418,551 @@ zero_loop_encodeBlockAsm4MB: MOVQ src_base+24(FP), DX search_loop_encodeBlockAsm4MB: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x06, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x06, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBlockAsm4MB - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 SHLQ $0x10, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x32, R10 - SHLQ $0x10, R11 - IMULQ R9, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 JNE no_repeat_found_encodeBlockAsm4MB - LEAL 1(CX), DI - MOVL 12(SP), R8 - MOVL DI, SI - SUBL 16(SP), SI + LEAL 1(CX), SI + MOVL 12(SP), DI + MOVL SI, BX + SUBL 16(SP), BX JZ repeat_extend_back_end_encodeBlockAsm4MB repeat_extend_back_loop_encodeBlockAsm4MB: - CMPL DI, R8 + CMPL SI, DI JLE repeat_extend_back_end_encodeBlockAsm4MB - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(BX*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeBlockAsm4MB - LEAL -1(DI), DI - DECL SI + LEAL -1(SI), SI + DECL BX JNZ repeat_extend_back_loop_encodeBlockAsm4MB repeat_extend_back_end_encodeBlockAsm4MB: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeBlockAsm4MB - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeBlockAsm4MB - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeBlockAsm4MB - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_repeat_emit_encodeBlockAsm4MB - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_repeat_emit_encodeBlockAsm4MB three_bytes_repeat_emit_encodeBlockAsm4MB: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeBlockAsm4MB two_bytes_repeat_emit_encodeBlockAsm4MB: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeBlockAsm4MB JMP memmove_long_repeat_emit_encodeBlockAsm4MB one_byte_repeat_emit_encodeBlockAsm4MB: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeBlockAsm4MB: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_repeat_emit_encodeBlockAsm4MB emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm4MB emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm4MB emit_lit_memmove_repeat_emit_encodeBlockAsm4MB_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_repeat_emit_encodeBlockAsm4MB: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeBlockAsm4MB memmove_long_repeat_emit_encodeBlockAsm4MB: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R12 - SHRQ $0x05, R12 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R13 - SUBQ R11, R13 - DECQ R12 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R11 + SHRQ $0x05, R11 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R12 + SUBQ R10, R12 + DECQ R11 JA emit_lit_memmove_long_repeat_emit_encodeBlockAsm4MBlarge_forward_sse_loop_32 - LEAQ -32(R10)(R13*1), R11 - LEAQ -32(AX)(R13*1), R14 + LEAQ -32(R9)(R12*1), R10 + LEAQ -32(AX)(R12*1), R13 emit_lit_memmove_long_repeat_emit_encodeBlockAsm4MBlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R14) - MOVOA X5, 16(R14) - ADDQ $0x20, R14 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R13) + MOVOA X5, 16(R13) ADDQ $0x20, R13 - DECQ R12 + ADDQ $0x20, R10 + ADDQ $0x20, R12 + DECQ R11 JNA emit_lit_memmove_long_repeat_emit_encodeBlockAsm4MBlarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeBlockAsm4MBlarge_forward_sse_loop_32: - MOVOU -32(R10)(R13*1), X4 - MOVOU -16(R10)(R13*1), X5 - MOVOA X4, -32(AX)(R13*1) - MOVOA X5, -16(AX)(R13*1) - ADDQ $0x20, R13 - CMPQ R9, R13 + MOVOU -32(R9)(R12*1), X4 + MOVOU -16(R9)(R12*1), X5 + MOVOA X4, -32(AX)(R12*1) + MOVOA X5, -16(AX)(R12*1) + ADDQ $0x20, R12 + CMPQ R8, R12 JAE emit_lit_memmove_long_repeat_emit_encodeBlockAsm4MBlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeBlockAsm4MB: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R9 - SUBL CX, R9 - LEAQ (DX)(CX*1), R10 - LEAQ (DX)(SI*1), SI + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+32(FP), R8 + SUBL CX, R8 + LEAQ (DX)(CX*1), R9 + LEAQ (DX)(BX*1), BX // matchLen - XORL R12, R12 - CMPL R9, $0x08 + XORL R11, R11 + CMPL R8, $0x08 JL matchlen_match4_repeat_extend_encodeBlockAsm4MB matchlen_loopback_repeat_extend_encodeBlockAsm4MB: - MOVQ (R10)(R12*1), R11 - XORQ (SI)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R9)(R11*1), R10 + XORQ (BX)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_repeat_extend_encodeBlockAsm4MB #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP repeat_extend_forward_end_encodeBlockAsm4MB matchlen_loop_repeat_extend_encodeBlockAsm4MB: - LEAL -8(R9), R9 - LEAL 8(R12), R12 - CMPL R9, $0x08 + LEAL -8(R8), R8 + LEAL 8(R11), R11 + CMPL R8, $0x08 JGE matchlen_loopback_repeat_extend_encodeBlockAsm4MB JZ repeat_extend_forward_end_encodeBlockAsm4MB matchlen_match4_repeat_extend_encodeBlockAsm4MB: - CMPL R9, $0x04 + CMPL R8, $0x04 JL matchlen_match2_repeat_extend_encodeBlockAsm4MB - MOVL (R10)(R12*1), R11 - CMPL (SI)(R12*1), R11 + MOVL (R9)(R11*1), R10 + CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm4MB - SUBL $0x04, R9 - LEAL 4(R12), R12 + SUBL $0x04, R8 + LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm4MB: - CMPL R9, $0x02 + CMPL R8, $0x02 JL matchlen_match1_repeat_extend_encodeBlockAsm4MB - MOVW (R10)(R12*1), R11 - CMPW (SI)(R12*1), R11 + MOVW (R9)(R11*1), R10 + CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm4MB - SUBL $0x02, R9 - LEAL 2(R12), R12 + SUBL $0x02, R8 + LEAL 2(R11), R11 matchlen_match1_repeat_extend_encodeBlockAsm4MB: - CMPL R9, $0x01 + CMPL R8, $0x01 JL repeat_extend_forward_end_encodeBlockAsm4MB - MOVB (R10)(R12*1), R11 - CMPB (SI)(R12*1), R11 + MOVB (R9)(R11*1), R10 + CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm4MB - LEAL 1(R12), R12 + LEAL 1(R11), R11 repeat_extend_forward_end_encodeBlockAsm4MB: - ADDL R12, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - TESTL R8, R8 + ADDL R11, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + TESTL DI, DI JZ repeat_as_copy_encodeBlockAsm4MB // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_match_repeat_encodeBlockAsm4MB - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_match_repeat_encodeBlockAsm4MB - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_match_repeat_encodeBlockAsm4MB cant_repeat_two_offset_match_repeat_encodeBlockAsm4MB: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_match_repeat_encodeBlockAsm4MB - CMPL SI, $0x00010100 + CMPL BX, $0x00010100 JLT repeat_four_match_repeat_encodeBlockAsm4MB - LEAL -65536(SI), SI - MOVL SI, DI + LEAL -65536(BX), BX + MOVL BX, SI MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) ADDQ $0x05, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_four_match_repeat_encodeBlockAsm4MB: - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_three_match_repeat_encodeBlockAsm4MB: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_match_repeat_encodeBlockAsm4MB: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_offset_match_repeat_encodeBlockAsm4MB: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_as_copy_encodeBlockAsm4MB: // emitCopy - CMPL DI, $0x00010000 + CMPL SI, $0x00010000 JL two_byte_offset_repeat_as_copy_encodeBlockAsm4MB - -four_bytes_loop_back_repeat_as_copy_encodeBlockAsm4MB: - CMPL SI, $0x40 + CMPL BX, $0x40 JLE four_bytes_remain_repeat_as_copy_encodeBlockAsm4MB MOVB $0xff, (AX) - MOVL DI, 1(AX) - LEAL -64(SI), SI + MOVL SI, 1(AX) + LEAL -64(BX), BX ADDQ $0x05, AX - CMPL SI, $0x04 + CMPL BX, $0x04 JL four_bytes_remain_repeat_as_copy_encodeBlockAsm4MB // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy - CMPL SI, $0x00010100 + CMPL BX, $0x00010100 JLT repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy - LEAL -65536(SI), SI - MOVL SI, DI + LEAL -65536(BX), BX + MOVL BX, SI MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) ADDQ $0x05, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy: - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB - JMP four_bytes_loop_back_repeat_as_copy_encodeBlockAsm4MB four_bytes_remain_repeat_as_copy_encodeBlockAsm4MB: - TESTL SI, SI + TESTL BX, BX JZ repeat_end_emit_encodeBlockAsm4MB - MOVB $0x03, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVL DI, 1(AX) + XORL DI, DI + LEAL -1(DI)(BX*4), BX + MOVB BL, (AX) + MOVL SI, 1(AX) ADDQ $0x05, AX JMP repeat_end_emit_encodeBlockAsm4MB two_byte_offset_repeat_as_copy_encodeBlockAsm4MB: - CMPL SI, $0x40 + CMPL BX, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm4MB - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JAE long_offset_short_repeat_as_copy_encodeBlockAsm4MB - MOVL $0x00000001, R8 - LEAL 16(R8), R8 - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, R8 - MOVB R8, (AX) + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX - SUBL $0x08, SI + SUBL $0x08, BX // emitRepeat - LEAL -4(SI), SI + LEAL -4(BX), BX JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b - CMPL SI, $0x00010100 + CMPL BX, $0x00010100 JLT repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b - LEAL -65536(SI), SI - MOVL SI, DI + LEAL -65536(BX), BX + MOVL BX, SI MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) ADDQ $0x05, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short_2b: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB long_offset_short_repeat_as_copy_encodeBlockAsm4MB: MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI + MOVW SI, 1(AX) + LEAL -60(BX), BX ADDQ $0x03, AX // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short - CMPL SI, $0x00010100 + CMPL BX, $0x00010100 JLT repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short - LEAL -65536(SI), SI - MOVL SI, DI + LEAL -65536(BX), BX + MOVL BX, SI MOVW $0x001d, (AX) - MOVW SI, 2(AX) - SARL $0x10, DI - MOVB DI, 4(AX) + MOVW BX, 2(AX) + SARL $0x10, SI + MOVB SI, 4(AX) ADDQ $0x05, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_four_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short: - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_three_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB repeat_two_offset_repeat_as_copy_encodeBlockAsm4MB_emit_copy_short: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB - JMP two_byte_offset_repeat_as_copy_encodeBlockAsm4MB two_byte_offset_short_repeat_as_copy_encodeBlockAsm4MB: - CMPL SI, $0x0c + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c JGE emit_copy_three_repeat_as_copy_encodeBlockAsm4MB - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JGE emit_copy_three_repeat_as_copy_encodeBlockAsm4MB - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm4MB emit_copy_three_repeat_as_copy_encodeBlockAsm4MB: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) ADDQ $0x03, AX repeat_end_emit_encodeBlockAsm4MB: @@ -1990,16 +1970,16 @@ repeat_end_emit_encodeBlockAsm4MB: JMP search_loop_encodeBlockAsm4MB no_repeat_found_encodeBlockAsm4MB: - CMPL (DX)(SI*1), DI + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBlockAsm4MB - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI JEQ candidate2_match_encodeBlockAsm4MB - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI JEQ candidate3_match_encodeBlockAsm4MB MOVL 20(SP), CX JMP search_loop_encodeBlockAsm4MB @@ -2009,506 +1989,502 @@ candidate3_match_encodeBlockAsm4MB: JMP candidate_match_encodeBlockAsm4MB candidate2_match_encodeBlockAsm4MB: - MOVL R9, 24(SP)(R10*4) + MOVL R8, 24(SP)(R9*4) INCL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBlockAsm4MB: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBlockAsm4MB match_extend_back_loop_encodeBlockAsm4MB: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBlockAsm4MB - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBlockAsm4MB LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBlockAsm4MB JMP match_extend_back_loop_encodeBlockAsm4MB match_extend_back_end_encodeBlockAsm4MB: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 4(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 4(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBlockAsm4MB MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBlockAsm4MB: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI JEQ emit_literal_done_match_emit_encodeBlockAsm4MB - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c JLT one_byte_match_emit_encodeBlockAsm4MB - CMPL R8, $0x00000100 + CMPL DI, $0x00000100 JLT two_bytes_match_emit_encodeBlockAsm4MB - CMPL R8, $0x00010000 + CMPL DI, $0x00010000 JLT three_bytes_match_emit_encodeBlockAsm4MB - MOVL R8, R10 - SHRL $0x10, R10 + MOVL DI, R9 + SHRL $0x10, R9 MOVB $0xf8, (AX) - MOVW R8, 1(AX) - MOVB R10, 3(AX) + MOVW DI, 1(AX) + MOVB R9, 3(AX) ADDQ $0x04, AX JMP memmove_long_match_emit_encodeBlockAsm4MB three_bytes_match_emit_encodeBlockAsm4MB: MOVB $0xf4, (AX) - MOVW R8, 1(AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBlockAsm4MB two_bytes_match_emit_encodeBlockAsm4MB: MOVB $0xf0, (AX) - MOVB R8, 1(AX) + MOVB DI, 1(AX) ADDQ $0x02, AX - CMPL R8, $0x40 + CMPL DI, $0x40 JL memmove_match_emit_encodeBlockAsm4MB JMP memmove_long_match_emit_encodeBlockAsm4MB one_byte_match_emit_encodeBlockAsm4MB: - SHLB $0x02, R8 - MOVB R8, (AX) + SHLB $0x02, DI + MOVB DI, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBlockAsm4MB: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) + MOVQ (SI), R9 + MOVQ R9, (AX) JMP memmove_end_copy_match_emit_encodeBlockAsm4MB emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm4MB emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm4MB emit_lit_memmove_match_emit_encodeBlockAsm4MB_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBlockAsm4MB: - MOVQ R8, AX + MOVQ DI, AX JMP emit_literal_done_match_emit_encodeBlockAsm4MB memmove_long_match_emit_encodeBlockAsm4MB: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_match_emit_encodeBlockAsm4MBlarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_match_emit_encodeBlockAsm4MBlarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_match_emit_encodeBlockAsm4MBlarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBlockAsm4MBlarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 JAE emit_lit_memmove_long_match_emit_encodeBlockAsm4MBlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX emit_literal_done_match_emit_encodeBlockAsm4MB: match_nolit_loop_encodeBlockAsm4MB: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), DI - SUBL CX, DI - LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX // matchLen - XORL R10, R10 - CMPL DI, $0x08 + XORL R9, R9 + CMPL SI, $0x08 JL matchlen_match4_match_nolit_encodeBlockAsm4MB matchlen_loopback_match_nolit_encodeBlockAsm4MB: - MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 - TESTQ R9, R9 + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 JZ matchlen_loop_match_nolit_encodeBlockAsm4MB #ifdef GOAMD64_v3 - TZCNTQ R9, R9 + TZCNTQ R8, R8 #else - BSFQ R9, R9 + BSFQ R8, R8 #endif - SARQ $0x03, R9 - LEAL (R10)(R9*1), R10 + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 JMP match_nolit_end_encodeBlockAsm4MB matchlen_loop_match_nolit_encodeBlockAsm4MB: - LEAL -8(DI), DI - LEAL 8(R10), R10 - CMPL DI, $0x08 + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeBlockAsm4MB JZ match_nolit_end_encodeBlockAsm4MB matchlen_match4_match_nolit_encodeBlockAsm4MB: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeBlockAsm4MB - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm4MB - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm4MB: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeBlockAsm4MB - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm4MB - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeBlockAsm4MB: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeBlockAsm4MB - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm4MB - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeBlockAsm4MB: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JL two_byte_offset_match_nolit_encodeBlockAsm4MB - -four_bytes_loop_back_match_nolit_encodeBlockAsm4MB: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE four_bytes_remain_match_nolit_encodeBlockAsm4MB MOVB $0xff, (AX) - MOVL SI, 1(AX) - LEAL -64(R10), R10 + MOVL BX, 1(AX) + LEAL -64(R9), R9 ADDQ $0x05, AX - CMPL R10, $0x04 + CMPL R9, $0x04 JL four_bytes_remain_match_nolit_encodeBlockAsm4MB // emitRepeat - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy - CMPL R10, $0x00010100 + CMPL R9, $0x00010100 JLT repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy - LEAL -65536(R10), R10 - MOVL R10, SI + LEAL -65536(R9), R9 + MOVL R9, BX MOVW $0x001d, (AX) - MOVW R10, 2(AX) - SARL $0x10, SI - MOVB SI, 4(AX) + MOVW R9, 2(AX) + SARL $0x10, BX + MOVB BL, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy: - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB - JMP four_bytes_loop_back_match_nolit_encodeBlockAsm4MB four_bytes_remain_match_nolit_encodeBlockAsm4MB: - TESTL R10, R10 + TESTL R9, R9 JZ match_nolit_emitcopy_end_encodeBlockAsm4MB - MOVB $0x03, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVL SI, 1(AX) + XORL SI, SI + LEAL -1(SI)(R9*4), R9 + MOVB R9, (AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB two_byte_offset_match_nolit_encodeBlockAsm4MB: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm4MB - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JAE long_offset_short_match_nolit_encodeBlockAsm4MB - MOVL $0x00000001, DI - LEAL 16(DI), DI - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, DI - MOVB DI, (AX) + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX - SUBL $0x08, R10 + SUBL $0x08, R9 // emitRepeat - LEAL -4(R10), R10 + LEAL -4(R9), R9 JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b - CMPL R10, $0x00010100 + CMPL R9, $0x00010100 JLT repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b - LEAL -65536(R10), R10 - MOVL R10, SI + LEAL -65536(R9), R9 + MOVL R9, BX MOVW $0x001d, (AX) - MOVW R10, 2(AX) - SARL $0x10, SI - MOVB SI, 4(AX) + MOVW R9, 2(AX) + SARL $0x10, BX + MOVB BL, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short_2b: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB long_offset_short_match_nolit_encodeBlockAsm4MB: MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX // emitRepeat - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy_short - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy_short - CMPL R10, $0x00010100 + CMPL R9, $0x00010100 JLT repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy_short - LEAL -65536(R10), R10 - MOVL R10, SI + LEAL -65536(R9), R9 + MOVL R9, BX MOVW $0x001d, (AX) - MOVW R10, 2(AX) - SARL $0x10, SI - MOVB SI, 4(AX) + MOVW R9, 2(AX) + SARL $0x10, BX + MOVB BL, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_four_match_nolit_encodeBlockAsm4MB_emit_copy_short: - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_three_match_nolit_encodeBlockAsm4MB_emit_copy_short: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_two_match_nolit_encodeBlockAsm4MB_emit_copy_short: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB repeat_two_offset_match_nolit_encodeBlockAsm4MB_emit_copy_short: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB - JMP two_byte_offset_match_nolit_encodeBlockAsm4MB two_byte_offset_short_match_nolit_encodeBlockAsm4MB: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeBlockAsm4MB - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeBlockAsm4MB - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm4MB emit_copy_three_match_nolit_encodeBlockAsm4MB: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeBlockAsm4MB: CMPL CX, 8(SP) JGE emit_remainder_encodeBlockAsm4MB - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeBlockAsm4MB MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeBlockAsm4MB: - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x10, R8 - IMULQ R9, R8 - SHRQ $0x32, R8 - SHLQ $0x10, SI - IMULQ R9, SI - SHRQ $0x32, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x10, DI + IMULQ R8, DI + SHRQ $0x32, DI + SHLQ $0x10, BX + IMULQ R8, BX + SHRQ $0x32, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeBlockAsm4MB INCL CX JMP search_loop_encodeBlockAsm4MB @@ -2704,8 +2680,8 @@ zero_loop_encodeBlockAsm12B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -2715,428 +2691,426 @@ zero_loop_encodeBlockAsm12B: MOVQ src_base+24(FP), DX search_loop_encodeBlockAsm12B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x05, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBlockAsm12B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x000000cf1bbcdcbb, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x000000cf1bbcdcbb, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x18, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 SHLQ $0x18, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x34, R10 - SHLQ $0x18, R11 - IMULQ R9, R11 - SHRQ $0x34, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x18, R10 - IMULQ R9, R10 - SHRQ $0x34, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x18, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 JNE no_repeat_found_encodeBlockAsm12B - LEAL 1(CX), DI - MOVL 12(SP), R8 - MOVL DI, SI - SUBL 16(SP), SI + LEAL 1(CX), SI + MOVL 12(SP), DI + MOVL SI, BX + SUBL 16(SP), BX JZ repeat_extend_back_end_encodeBlockAsm12B repeat_extend_back_loop_encodeBlockAsm12B: - CMPL DI, R8 + CMPL SI, DI JLE repeat_extend_back_end_encodeBlockAsm12B - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(BX*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeBlockAsm12B - LEAL -1(DI), DI - DECL SI + LEAL -1(SI), SI + DECL BX JNZ repeat_extend_back_loop_encodeBlockAsm12B repeat_extend_back_end_encodeBlockAsm12B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeBlockAsm12B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeBlockAsm12B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeBlockAsm12B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeBlockAsm12B two_bytes_repeat_emit_encodeBlockAsm12B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeBlockAsm12B JMP memmove_long_repeat_emit_encodeBlockAsm12B one_byte_repeat_emit_encodeBlockAsm12B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_repeat_emit_encodeBlockAsm12B emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm12B emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm12B emit_lit_memmove_repeat_emit_encodeBlockAsm12B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_repeat_emit_encodeBlockAsm12B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeBlockAsm12B memmove_long_repeat_emit_encodeBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R12 - SHRQ $0x05, R12 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R13 - SUBQ R11, R13 - DECQ R12 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R11 + SHRQ $0x05, R11 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R12 + SUBQ R10, R12 + DECQ R11 JA emit_lit_memmove_long_repeat_emit_encodeBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R13*1), R11 - LEAQ -32(AX)(R13*1), R14 + LEAQ -32(R9)(R12*1), R10 + LEAQ -32(AX)(R12*1), R13 emit_lit_memmove_long_repeat_emit_encodeBlockAsm12Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R14) - MOVOA X5, 16(R14) - ADDQ $0x20, R14 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R13) + MOVOA X5, 16(R13) ADDQ $0x20, R13 - DECQ R12 + ADDQ $0x20, R10 + ADDQ $0x20, R12 + DECQ R11 JNA emit_lit_memmove_long_repeat_emit_encodeBlockAsm12Blarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R13*1), X4 - MOVOU -16(R10)(R13*1), X5 - MOVOA X4, -32(AX)(R13*1) - MOVOA X5, -16(AX)(R13*1) - ADDQ $0x20, R13 - CMPQ R9, R13 + MOVOU -32(R9)(R12*1), X4 + MOVOU -16(R9)(R12*1), X5 + MOVOA X4, -32(AX)(R12*1) + MOVOA X5, -16(AX)(R12*1) + ADDQ $0x20, R12 + CMPQ R8, R12 JAE emit_lit_memmove_long_repeat_emit_encodeBlockAsm12Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeBlockAsm12B: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R9 - SUBL CX, R9 - LEAQ (DX)(CX*1), R10 - LEAQ (DX)(SI*1), SI + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+32(FP), R8 + SUBL CX, R8 + LEAQ (DX)(CX*1), R9 + LEAQ (DX)(BX*1), BX // matchLen - XORL R12, R12 - CMPL R9, $0x08 + XORL R11, R11 + CMPL R8, $0x08 JL matchlen_match4_repeat_extend_encodeBlockAsm12B matchlen_loopback_repeat_extend_encodeBlockAsm12B: - MOVQ (R10)(R12*1), R11 - XORQ (SI)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R9)(R11*1), R10 + XORQ (BX)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_repeat_extend_encodeBlockAsm12B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP repeat_extend_forward_end_encodeBlockAsm12B matchlen_loop_repeat_extend_encodeBlockAsm12B: - LEAL -8(R9), R9 - LEAL 8(R12), R12 - CMPL R9, $0x08 + LEAL -8(R8), R8 + LEAL 8(R11), R11 + CMPL R8, $0x08 JGE matchlen_loopback_repeat_extend_encodeBlockAsm12B JZ repeat_extend_forward_end_encodeBlockAsm12B matchlen_match4_repeat_extend_encodeBlockAsm12B: - CMPL R9, $0x04 + CMPL R8, $0x04 JL matchlen_match2_repeat_extend_encodeBlockAsm12B - MOVL (R10)(R12*1), R11 - CMPL (SI)(R12*1), R11 + MOVL (R9)(R11*1), R10 + CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm12B - SUBL $0x04, R9 - LEAL 4(R12), R12 + SUBL $0x04, R8 + LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm12B: - CMPL R9, $0x02 + CMPL R8, $0x02 JL matchlen_match1_repeat_extend_encodeBlockAsm12B - MOVW (R10)(R12*1), R11 - CMPW (SI)(R12*1), R11 + MOVW (R9)(R11*1), R10 + CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm12B - SUBL $0x02, R9 - LEAL 2(R12), R12 + SUBL $0x02, R8 + LEAL 2(R11), R11 matchlen_match1_repeat_extend_encodeBlockAsm12B: - CMPL R9, $0x01 + CMPL R8, $0x01 JL repeat_extend_forward_end_encodeBlockAsm12B - MOVB (R10)(R12*1), R11 - CMPB (SI)(R12*1), R11 + MOVB (R9)(R11*1), R10 + CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm12B - LEAL 1(R12), R12 + LEAL 1(R11), R11 repeat_extend_forward_end_encodeBlockAsm12B: - ADDL R12, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - TESTL R8, R8 + ADDL R11, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + TESTL DI, DI JZ repeat_as_copy_encodeBlockAsm12B // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_match_repeat_encodeBlockAsm12B - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_match_repeat_encodeBlockAsm12B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_match_repeat_encodeBlockAsm12B cant_repeat_two_offset_match_repeat_encodeBlockAsm12B: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_match_repeat_encodeBlockAsm12B - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_three_match_repeat_encodeBlockAsm12B: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_two_match_repeat_encodeBlockAsm12B: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_two_offset_match_repeat_encodeBlockAsm12B: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_as_copy_encodeBlockAsm12B: // emitCopy -two_byte_offset_repeat_as_copy_encodeBlockAsm12B: - CMPL SI, $0x40 + CMPL BX, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm12B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JAE long_offset_short_repeat_as_copy_encodeBlockAsm12B - MOVL $0x00000001, R8 - LEAL 16(R8), R8 - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, R8 - MOVB R8, (AX) + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX - SUBL $0x08, SI + SUBL $0x08, BX // emitRepeat - LEAL -4(SI), SI + LEAL -4(BX), BX JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_three_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_two_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short_2b: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B long_offset_short_repeat_as_copy_encodeBlockAsm12B: MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI + MOVW SI, 1(AX) + LEAL -60(BX), BX ADDQ $0x03, AX // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm12B_emit_copy_short - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm12B_emit_copy_short - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_three_repeat_as_copy_encodeBlockAsm12B_emit_copy_short: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_two_repeat_as_copy_encodeBlockAsm12B_emit_copy_short: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B repeat_two_offset_repeat_as_copy_encodeBlockAsm12B_emit_copy_short: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B - JMP two_byte_offset_repeat_as_copy_encodeBlockAsm12B two_byte_offset_short_repeat_as_copy_encodeBlockAsm12B: - CMPL SI, $0x0c + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c JGE emit_copy_three_repeat_as_copy_encodeBlockAsm12B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JGE emit_copy_three_repeat_as_copy_encodeBlockAsm12B - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm12B emit_copy_three_repeat_as_copy_encodeBlockAsm12B: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) ADDQ $0x03, AX repeat_end_emit_encodeBlockAsm12B: @@ -3144,16 +3118,16 @@ repeat_end_emit_encodeBlockAsm12B: JMP search_loop_encodeBlockAsm12B no_repeat_found_encodeBlockAsm12B: - CMPL (DX)(SI*1), DI + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBlockAsm12B - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI JEQ candidate2_match_encodeBlockAsm12B - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI JEQ candidate3_match_encodeBlockAsm12B MOVL 20(SP), CX JMP search_loop_encodeBlockAsm12B @@ -3163,391 +3137,389 @@ candidate3_match_encodeBlockAsm12B: JMP candidate_match_encodeBlockAsm12B candidate2_match_encodeBlockAsm12B: - MOVL R9, 24(SP)(R10*4) + MOVL R8, 24(SP)(R9*4) INCL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBlockAsm12B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBlockAsm12B match_extend_back_loop_encodeBlockAsm12B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBlockAsm12B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBlockAsm12B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBlockAsm12B JMP match_extend_back_loop_encodeBlockAsm12B match_extend_back_end_encodeBlockAsm12B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBlockAsm12B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBlockAsm12B: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI JEQ emit_literal_done_match_emit_encodeBlockAsm12B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c JLT one_byte_match_emit_encodeBlockAsm12B - CMPL R8, $0x00000100 + CMPL DI, $0x00000100 JLT two_bytes_match_emit_encodeBlockAsm12B MOVB $0xf4, (AX) - MOVW R8, 1(AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBlockAsm12B two_bytes_match_emit_encodeBlockAsm12B: MOVB $0xf0, (AX) - MOVB R8, 1(AX) + MOVB DI, 1(AX) ADDQ $0x02, AX - CMPL R8, $0x40 + CMPL DI, $0x40 JL memmove_match_emit_encodeBlockAsm12B JMP memmove_long_match_emit_encodeBlockAsm12B one_byte_match_emit_encodeBlockAsm12B: - SHLB $0x02, R8 - MOVB R8, (AX) + SHLB $0x02, DI + MOVB DI, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBlockAsm12B: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) + MOVQ (SI), R9 + MOVQ R9, (AX) JMP memmove_end_copy_match_emit_encodeBlockAsm12B emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm12B emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm12B emit_lit_memmove_match_emit_encodeBlockAsm12B_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBlockAsm12B: - MOVQ R8, AX + MOVQ DI, AX JMP emit_literal_done_match_emit_encodeBlockAsm12B memmove_long_match_emit_encodeBlockAsm12B: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_match_emit_encodeBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_match_emit_encodeBlockAsm12Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_match_emit_encodeBlockAsm12Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 JAE emit_lit_memmove_long_match_emit_encodeBlockAsm12Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX emit_literal_done_match_emit_encodeBlockAsm12B: match_nolit_loop_encodeBlockAsm12B: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), DI - SUBL CX, DI - LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX // matchLen - XORL R10, R10 - CMPL DI, $0x08 + XORL R9, R9 + CMPL SI, $0x08 JL matchlen_match4_match_nolit_encodeBlockAsm12B matchlen_loopback_match_nolit_encodeBlockAsm12B: - MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 - TESTQ R9, R9 + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 JZ matchlen_loop_match_nolit_encodeBlockAsm12B #ifdef GOAMD64_v3 - TZCNTQ R9, R9 + TZCNTQ R8, R8 #else - BSFQ R9, R9 + BSFQ R8, R8 #endif - SARQ $0x03, R9 - LEAL (R10)(R9*1), R10 + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 JMP match_nolit_end_encodeBlockAsm12B matchlen_loop_match_nolit_encodeBlockAsm12B: - LEAL -8(DI), DI - LEAL 8(R10), R10 - CMPL DI, $0x08 + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeBlockAsm12B JZ match_nolit_end_encodeBlockAsm12B matchlen_match4_match_nolit_encodeBlockAsm12B: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeBlockAsm12B - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm12B - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm12B: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeBlockAsm12B - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm12B - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeBlockAsm12B: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeBlockAsm12B - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm12B - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeBlockAsm12B: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy -two_byte_offset_match_nolit_encodeBlockAsm12B: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm12B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JAE long_offset_short_match_nolit_encodeBlockAsm12B - MOVL $0x00000001, DI - LEAL 16(DI), DI - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, DI - MOVB DI, (AX) + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX - SUBL $0x08, R10 + SUBL $0x08, R9 // emitRepeat - LEAL -4(R10), R10 + LEAL -4(R9), R9 JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm12B_emit_copy_short_2b - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm12B_emit_copy_short_2b - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B repeat_three_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B repeat_two_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short_2b: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B long_offset_short_match_nolit_encodeBlockAsm12B: MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX // emitRepeat - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm12B_emit_copy_short - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm12B_emit_copy_short - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B repeat_three_match_nolit_encodeBlockAsm12B_emit_copy_short: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B repeat_two_match_nolit_encodeBlockAsm12B_emit_copy_short: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B repeat_two_offset_match_nolit_encodeBlockAsm12B_emit_copy_short: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B - JMP two_byte_offset_match_nolit_encodeBlockAsm12B two_byte_offset_short_match_nolit_encodeBlockAsm12B: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeBlockAsm12B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeBlockAsm12B - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm12B emit_copy_three_match_nolit_encodeBlockAsm12B: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeBlockAsm12B: CMPL CX, 8(SP) JGE emit_remainder_encodeBlockAsm12B - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeBlockAsm12B MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeBlockAsm12B: - MOVQ $0x000000cf1bbcdcbb, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x18, R8 - IMULQ R9, R8 - SHRQ $0x34, R8 - SHLQ $0x18, SI - IMULQ R9, SI - SHRQ $0x34, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x000000cf1bbcdcbb, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x18, DI + IMULQ R8, DI + SHRQ $0x34, DI + SHLQ $0x18, BX + IMULQ R8, BX + SHRQ $0x34, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeBlockAsm12B INCL CX JMP search_loop_encodeBlockAsm12B @@ -3732,8 +3704,8 @@ zero_loop_encodeBlockAsm10B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -3743,428 +3715,426 @@ zero_loop_encodeBlockAsm10B: MOVQ src_base+24(FP), DX search_loop_encodeBlockAsm10B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x05, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBlockAsm10B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x9e3779b1, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x9e3779b1, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 SHLQ $0x20, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x36, R10 - SHLQ $0x20, R11 - IMULQ R9, R11 - SHRQ $0x36, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x20, R10 - IMULQ R9, R10 - SHRQ $0x36, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 JNE no_repeat_found_encodeBlockAsm10B - LEAL 1(CX), DI - MOVL 12(SP), R8 - MOVL DI, SI - SUBL 16(SP), SI + LEAL 1(CX), SI + MOVL 12(SP), DI + MOVL SI, BX + SUBL 16(SP), BX JZ repeat_extend_back_end_encodeBlockAsm10B repeat_extend_back_loop_encodeBlockAsm10B: - CMPL DI, R8 + CMPL SI, DI JLE repeat_extend_back_end_encodeBlockAsm10B - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(BX*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeBlockAsm10B - LEAL -1(DI), DI - DECL SI + LEAL -1(SI), SI + DECL BX JNZ repeat_extend_back_loop_encodeBlockAsm10B repeat_extend_back_end_encodeBlockAsm10B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeBlockAsm10B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeBlockAsm10B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeBlockAsm10B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeBlockAsm10B two_bytes_repeat_emit_encodeBlockAsm10B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeBlockAsm10B JMP memmove_long_repeat_emit_encodeBlockAsm10B one_byte_repeat_emit_encodeBlockAsm10B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_repeat_emit_encodeBlockAsm10B emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm10B emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm10B emit_lit_memmove_repeat_emit_encodeBlockAsm10B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_repeat_emit_encodeBlockAsm10B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeBlockAsm10B memmove_long_repeat_emit_encodeBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R12 - SHRQ $0x05, R12 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R13 - SUBQ R11, R13 - DECQ R12 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R11 + SHRQ $0x05, R11 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R12 + SUBQ R10, R12 + DECQ R11 JA emit_lit_memmove_long_repeat_emit_encodeBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R13*1), R11 - LEAQ -32(AX)(R13*1), R14 + LEAQ -32(R9)(R12*1), R10 + LEAQ -32(AX)(R12*1), R13 emit_lit_memmove_long_repeat_emit_encodeBlockAsm10Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R14) - MOVOA X5, 16(R14) - ADDQ $0x20, R14 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R13) + MOVOA X5, 16(R13) ADDQ $0x20, R13 - DECQ R12 + ADDQ $0x20, R10 + ADDQ $0x20, R12 + DECQ R11 JNA emit_lit_memmove_long_repeat_emit_encodeBlockAsm10Blarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R13*1), X4 - MOVOU -16(R10)(R13*1), X5 - MOVOA X4, -32(AX)(R13*1) - MOVOA X5, -16(AX)(R13*1) - ADDQ $0x20, R13 - CMPQ R9, R13 + MOVOU -32(R9)(R12*1), X4 + MOVOU -16(R9)(R12*1), X5 + MOVOA X4, -32(AX)(R12*1) + MOVOA X5, -16(AX)(R12*1) + ADDQ $0x20, R12 + CMPQ R8, R12 JAE emit_lit_memmove_long_repeat_emit_encodeBlockAsm10Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeBlockAsm10B: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R9 - SUBL CX, R9 - LEAQ (DX)(CX*1), R10 - LEAQ (DX)(SI*1), SI + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+32(FP), R8 + SUBL CX, R8 + LEAQ (DX)(CX*1), R9 + LEAQ (DX)(BX*1), BX // matchLen - XORL R12, R12 - CMPL R9, $0x08 + XORL R11, R11 + CMPL R8, $0x08 JL matchlen_match4_repeat_extend_encodeBlockAsm10B matchlen_loopback_repeat_extend_encodeBlockAsm10B: - MOVQ (R10)(R12*1), R11 - XORQ (SI)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R9)(R11*1), R10 + XORQ (BX)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_repeat_extend_encodeBlockAsm10B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP repeat_extend_forward_end_encodeBlockAsm10B matchlen_loop_repeat_extend_encodeBlockAsm10B: - LEAL -8(R9), R9 - LEAL 8(R12), R12 - CMPL R9, $0x08 + LEAL -8(R8), R8 + LEAL 8(R11), R11 + CMPL R8, $0x08 JGE matchlen_loopback_repeat_extend_encodeBlockAsm10B JZ repeat_extend_forward_end_encodeBlockAsm10B matchlen_match4_repeat_extend_encodeBlockAsm10B: - CMPL R9, $0x04 + CMPL R8, $0x04 JL matchlen_match2_repeat_extend_encodeBlockAsm10B - MOVL (R10)(R12*1), R11 - CMPL (SI)(R12*1), R11 + MOVL (R9)(R11*1), R10 + CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm10B - SUBL $0x04, R9 - LEAL 4(R12), R12 + SUBL $0x04, R8 + LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm10B: - CMPL R9, $0x02 + CMPL R8, $0x02 JL matchlen_match1_repeat_extend_encodeBlockAsm10B - MOVW (R10)(R12*1), R11 - CMPW (SI)(R12*1), R11 + MOVW (R9)(R11*1), R10 + CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm10B - SUBL $0x02, R9 - LEAL 2(R12), R12 + SUBL $0x02, R8 + LEAL 2(R11), R11 matchlen_match1_repeat_extend_encodeBlockAsm10B: - CMPL R9, $0x01 + CMPL R8, $0x01 JL repeat_extend_forward_end_encodeBlockAsm10B - MOVB (R10)(R12*1), R11 - CMPB (SI)(R12*1), R11 + MOVB (R9)(R11*1), R10 + CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm10B - LEAL 1(R12), R12 + LEAL 1(R11), R11 repeat_extend_forward_end_encodeBlockAsm10B: - ADDL R12, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - TESTL R8, R8 + ADDL R11, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + TESTL DI, DI JZ repeat_as_copy_encodeBlockAsm10B // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_match_repeat_encodeBlockAsm10B - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_match_repeat_encodeBlockAsm10B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_match_repeat_encodeBlockAsm10B cant_repeat_two_offset_match_repeat_encodeBlockAsm10B: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_match_repeat_encodeBlockAsm10B - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_three_match_repeat_encodeBlockAsm10B: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_two_match_repeat_encodeBlockAsm10B: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_two_offset_match_repeat_encodeBlockAsm10B: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_as_copy_encodeBlockAsm10B: // emitCopy -two_byte_offset_repeat_as_copy_encodeBlockAsm10B: - CMPL SI, $0x40 + CMPL BX, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm10B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JAE long_offset_short_repeat_as_copy_encodeBlockAsm10B - MOVL $0x00000001, R8 - LEAL 16(R8), R8 - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, R8 - MOVB R8, (AX) + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX - SUBL $0x08, SI + SUBL $0x08, BX // emitRepeat - LEAL -4(SI), SI + LEAL -4(BX), BX JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_three_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_two_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short_2b: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B long_offset_short_repeat_as_copy_encodeBlockAsm10B: MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI + MOVW SI, 1(AX) + LEAL -60(BX), BX ADDQ $0x03, AX // emitRepeat - MOVL SI, R8 - LEAL -4(SI), SI - CMPL R8, $0x08 + MOVL BX, DI + LEAL -4(BX), BX + CMPL DI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm10B_emit_copy_short - CMPL R8, $0x0c + CMPL DI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JLT repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm10B_emit_copy_short - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_three_repeat_as_copy_encodeBlockAsm10B_emit_copy_short: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_two_repeat_as_copy_encodeBlockAsm10B_emit_copy_short: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B repeat_two_offset_repeat_as_copy_encodeBlockAsm10B_emit_copy_short: - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B - JMP two_byte_offset_repeat_as_copy_encodeBlockAsm10B two_byte_offset_short_repeat_as_copy_encodeBlockAsm10B: - CMPL SI, $0x0c + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c JGE emit_copy_three_repeat_as_copy_encodeBlockAsm10B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JGE emit_copy_three_repeat_as_copy_encodeBlockAsm10B - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm10B emit_copy_three_repeat_as_copy_encodeBlockAsm10B: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) ADDQ $0x03, AX repeat_end_emit_encodeBlockAsm10B: @@ -4172,16 +4142,16 @@ repeat_end_emit_encodeBlockAsm10B: JMP search_loop_encodeBlockAsm10B no_repeat_found_encodeBlockAsm10B: - CMPL (DX)(SI*1), DI + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBlockAsm10B - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI JEQ candidate2_match_encodeBlockAsm10B - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI JEQ candidate3_match_encodeBlockAsm10B MOVL 20(SP), CX JMP search_loop_encodeBlockAsm10B @@ -4191,391 +4161,389 @@ candidate3_match_encodeBlockAsm10B: JMP candidate_match_encodeBlockAsm10B candidate2_match_encodeBlockAsm10B: - MOVL R9, 24(SP)(R10*4) + MOVL R8, 24(SP)(R9*4) INCL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBlockAsm10B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBlockAsm10B match_extend_back_loop_encodeBlockAsm10B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBlockAsm10B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBlockAsm10B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBlockAsm10B JMP match_extend_back_loop_encodeBlockAsm10B match_extend_back_end_encodeBlockAsm10B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBlockAsm10B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBlockAsm10B: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI JEQ emit_literal_done_match_emit_encodeBlockAsm10B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c JLT one_byte_match_emit_encodeBlockAsm10B - CMPL R8, $0x00000100 + CMPL DI, $0x00000100 JLT two_bytes_match_emit_encodeBlockAsm10B MOVB $0xf4, (AX) - MOVW R8, 1(AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBlockAsm10B two_bytes_match_emit_encodeBlockAsm10B: MOVB $0xf0, (AX) - MOVB R8, 1(AX) + MOVB DI, 1(AX) ADDQ $0x02, AX - CMPL R8, $0x40 + CMPL DI, $0x40 JL memmove_match_emit_encodeBlockAsm10B JMP memmove_long_match_emit_encodeBlockAsm10B one_byte_match_emit_encodeBlockAsm10B: - SHLB $0x02, R8 - MOVB R8, (AX) + SHLB $0x02, DI + MOVB DI, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBlockAsm10B: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) + MOVQ (SI), R9 + MOVQ R9, (AX) JMP memmove_end_copy_match_emit_encodeBlockAsm10B emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm10B emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm10B emit_lit_memmove_match_emit_encodeBlockAsm10B_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBlockAsm10B: - MOVQ R8, AX + MOVQ DI, AX JMP emit_literal_done_match_emit_encodeBlockAsm10B memmove_long_match_emit_encodeBlockAsm10B: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_match_emit_encodeBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_match_emit_encodeBlockAsm10Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_match_emit_encodeBlockAsm10Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 JAE emit_lit_memmove_long_match_emit_encodeBlockAsm10Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX emit_literal_done_match_emit_encodeBlockAsm10B: match_nolit_loop_encodeBlockAsm10B: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), DI - SUBL CX, DI - LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX // matchLen - XORL R10, R10 - CMPL DI, $0x08 + XORL R9, R9 + CMPL SI, $0x08 JL matchlen_match4_match_nolit_encodeBlockAsm10B matchlen_loopback_match_nolit_encodeBlockAsm10B: - MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 - TESTQ R9, R9 + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 JZ matchlen_loop_match_nolit_encodeBlockAsm10B #ifdef GOAMD64_v3 - TZCNTQ R9, R9 + TZCNTQ R8, R8 #else - BSFQ R9, R9 + BSFQ R8, R8 #endif - SARQ $0x03, R9 - LEAL (R10)(R9*1), R10 + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 JMP match_nolit_end_encodeBlockAsm10B matchlen_loop_match_nolit_encodeBlockAsm10B: - LEAL -8(DI), DI - LEAL 8(R10), R10 - CMPL DI, $0x08 + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeBlockAsm10B JZ match_nolit_end_encodeBlockAsm10B matchlen_match4_match_nolit_encodeBlockAsm10B: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeBlockAsm10B - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm10B - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm10B: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeBlockAsm10B - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm10B - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeBlockAsm10B: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeBlockAsm10B - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm10B - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeBlockAsm10B: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy -two_byte_offset_match_nolit_encodeBlockAsm10B: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm10B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JAE long_offset_short_match_nolit_encodeBlockAsm10B - MOVL $0x00000001, DI - LEAL 16(DI), DI - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, DI - MOVB DI, (AX) + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX - SUBL $0x08, R10 + SUBL $0x08, R9 // emitRepeat - LEAL -4(R10), R10 + LEAL -4(R9), R9 JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm10B_emit_copy_short_2b - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm10B_emit_copy_short_2b - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B repeat_three_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B repeat_two_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short_2b: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B long_offset_short_match_nolit_encodeBlockAsm10B: MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX // emitRepeat - MOVL R10, DI - LEAL -4(R10), R10 - CMPL DI, $0x08 + MOVL R9, SI + LEAL -4(R9), R9 + CMPL SI, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm10B_emit_copy_short - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm10B_emit_copy_short - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B repeat_three_match_nolit_encodeBlockAsm10B_emit_copy_short: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B repeat_two_match_nolit_encodeBlockAsm10B_emit_copy_short: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B repeat_two_offset_match_nolit_encodeBlockAsm10B_emit_copy_short: - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B - JMP two_byte_offset_match_nolit_encodeBlockAsm10B two_byte_offset_short_match_nolit_encodeBlockAsm10B: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeBlockAsm10B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeBlockAsm10B - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm10B emit_copy_three_match_nolit_encodeBlockAsm10B: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeBlockAsm10B: CMPL CX, 8(SP) JGE emit_remainder_encodeBlockAsm10B - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeBlockAsm10B MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeBlockAsm10B: - MOVQ $0x9e3779b1, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x20, R8 - IMULQ R9, R8 - SHRQ $0x36, R8 - SHLQ $0x20, SI - IMULQ R9, SI - SHRQ $0x36, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x9e3779b1, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x20, DI + IMULQ R8, DI + SHRQ $0x36, DI + SHLQ $0x20, BX + IMULQ R8, BX + SHRQ $0x36, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeBlockAsm10B INCL CX JMP search_loop_encodeBlockAsm10B @@ -4760,8 +4728,8 @@ zero_loop_encodeBlockAsm8B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -4771,414 +4739,412 @@ zero_loop_encodeBlockAsm8B: MOVQ src_base+24(FP), DX search_loop_encodeBlockAsm8B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x04, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x04, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBlockAsm8B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x9e3779b1, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x9e3779b1, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x38, R9 SHLQ $0x20, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x38, R10 - SHLQ $0x20, R11 - IMULQ R9, R11 - SHRQ $0x38, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x20, R10 - IMULQ R9, R10 - SHRQ $0x38, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x38, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 JNE no_repeat_found_encodeBlockAsm8B - LEAL 1(CX), DI - MOVL 12(SP), R8 - MOVL DI, SI - SUBL 16(SP), SI + LEAL 1(CX), SI + MOVL 12(SP), DI + MOVL SI, BX + SUBL 16(SP), BX JZ repeat_extend_back_end_encodeBlockAsm8B repeat_extend_back_loop_encodeBlockAsm8B: - CMPL DI, R8 + CMPL SI, DI JLE repeat_extend_back_end_encodeBlockAsm8B - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(BX*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeBlockAsm8B - LEAL -1(DI), DI - DECL SI + LEAL -1(SI), SI + DECL BX JNZ repeat_extend_back_loop_encodeBlockAsm8B repeat_extend_back_end_encodeBlockAsm8B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeBlockAsm8B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeBlockAsm8B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeBlockAsm8B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeBlockAsm8B two_bytes_repeat_emit_encodeBlockAsm8B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeBlockAsm8B JMP memmove_long_repeat_emit_encodeBlockAsm8B one_byte_repeat_emit_encodeBlockAsm8B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeBlockAsm8B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_repeat_emit_encodeBlockAsm8B emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm8B emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_repeat_emit_encodeBlockAsm8B emit_lit_memmove_repeat_emit_encodeBlockAsm8B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_repeat_emit_encodeBlockAsm8B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeBlockAsm8B memmove_long_repeat_emit_encodeBlockAsm8B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R12 - SHRQ $0x05, R12 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R13 - SUBQ R11, R13 - DECQ R12 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R11 + SHRQ $0x05, R11 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R12 + SUBQ R10, R12 + DECQ R11 JA emit_lit_memmove_long_repeat_emit_encodeBlockAsm8Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R13*1), R11 - LEAQ -32(AX)(R13*1), R14 + LEAQ -32(R9)(R12*1), R10 + LEAQ -32(AX)(R12*1), R13 emit_lit_memmove_long_repeat_emit_encodeBlockAsm8Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R14) - MOVOA X5, 16(R14) - ADDQ $0x20, R14 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R13) + MOVOA X5, 16(R13) ADDQ $0x20, R13 - DECQ R12 + ADDQ $0x20, R10 + ADDQ $0x20, R12 + DECQ R11 JNA emit_lit_memmove_long_repeat_emit_encodeBlockAsm8Blarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeBlockAsm8Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R13*1), X4 - MOVOU -16(R10)(R13*1), X5 - MOVOA X4, -32(AX)(R13*1) - MOVOA X5, -16(AX)(R13*1) - ADDQ $0x20, R13 - CMPQ R9, R13 + MOVOU -32(R9)(R12*1), X4 + MOVOU -16(R9)(R12*1), X5 + MOVOA X4, -32(AX)(R12*1) + MOVOA X5, -16(AX)(R12*1) + ADDQ $0x20, R12 + CMPQ R8, R12 JAE emit_lit_memmove_long_repeat_emit_encodeBlockAsm8Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeBlockAsm8B: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R9 - SUBL CX, R9 - LEAQ (DX)(CX*1), R10 - LEAQ (DX)(SI*1), SI + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+32(FP), R8 + SUBL CX, R8 + LEAQ (DX)(CX*1), R9 + LEAQ (DX)(BX*1), BX // matchLen - XORL R12, R12 - CMPL R9, $0x08 + XORL R11, R11 + CMPL R8, $0x08 JL matchlen_match4_repeat_extend_encodeBlockAsm8B matchlen_loopback_repeat_extend_encodeBlockAsm8B: - MOVQ (R10)(R12*1), R11 - XORQ (SI)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R9)(R11*1), R10 + XORQ (BX)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_repeat_extend_encodeBlockAsm8B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP repeat_extend_forward_end_encodeBlockAsm8B matchlen_loop_repeat_extend_encodeBlockAsm8B: - LEAL -8(R9), R9 - LEAL 8(R12), R12 - CMPL R9, $0x08 + LEAL -8(R8), R8 + LEAL 8(R11), R11 + CMPL R8, $0x08 JGE matchlen_loopback_repeat_extend_encodeBlockAsm8B JZ repeat_extend_forward_end_encodeBlockAsm8B matchlen_match4_repeat_extend_encodeBlockAsm8B: - CMPL R9, $0x04 + CMPL R8, $0x04 JL matchlen_match2_repeat_extend_encodeBlockAsm8B - MOVL (R10)(R12*1), R11 - CMPL (SI)(R12*1), R11 + MOVL (R9)(R11*1), R10 + CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm8B - SUBL $0x04, R9 - LEAL 4(R12), R12 + SUBL $0x04, R8 + LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm8B: - CMPL R9, $0x02 + CMPL R8, $0x02 JL matchlen_match1_repeat_extend_encodeBlockAsm8B - MOVW (R10)(R12*1), R11 - CMPW (SI)(R12*1), R11 + MOVW (R9)(R11*1), R10 + CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm8B - SUBL $0x02, R9 - LEAL 2(R12), R12 + SUBL $0x02, R8 + LEAL 2(R11), R11 matchlen_match1_repeat_extend_encodeBlockAsm8B: - CMPL R9, $0x01 + CMPL R8, $0x01 JL repeat_extend_forward_end_encodeBlockAsm8B - MOVB (R10)(R12*1), R11 - CMPB (SI)(R12*1), R11 + MOVB (R9)(R11*1), R10 + CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm8B - LEAL 1(R12), R12 + LEAL 1(R11), R11 repeat_extend_forward_end_encodeBlockAsm8B: - ADDL R12, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - TESTL R8, R8 + ADDL R11, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + TESTL DI, DI JZ repeat_as_copy_encodeBlockAsm8B // emitRepeat - MOVL SI, DI - LEAL -4(SI), SI - CMPL DI, $0x08 + MOVL BX, SI + LEAL -4(BX), BX + CMPL SI, $0x08 JLE repeat_two_match_repeat_encodeBlockAsm8B - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_match_repeat_encodeBlockAsm8B cant_repeat_two_offset_match_repeat_encodeBlockAsm8B: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_match_repeat_encodeBlockAsm8B - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_three_match_repeat_encodeBlockAsm8B: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_two_match_repeat_encodeBlockAsm8B: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_as_copy_encodeBlockAsm8B: // emitCopy -two_byte_offset_repeat_as_copy_encodeBlockAsm8B: - CMPL SI, $0x40 + CMPL BX, $0x40 JLE two_byte_offset_short_repeat_as_copy_encodeBlockAsm8B - CMPL DI, $0x00000800 + CMPL SI, $0x00000800 JAE long_offset_short_repeat_as_copy_encodeBlockAsm8B - MOVL $0x00000001, R8 - LEAL 16(R8), R8 - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, R8 - MOVB R8, (AX) + MOVL $0x00000001, DI + LEAL 16(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX - SUBL $0x08, SI + SUBL $0x08, BX // emitRepeat - LEAL -4(SI), SI + LEAL -4(BX), BX JMP cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b - MOVL SI, DI - LEAL -4(SI), SI - CMPL DI, $0x08 + MOVL BX, SI + LEAL -4(BX), BX + CMPL SI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_three_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_two_repeat_as_copy_encodeBlockAsm8B_emit_copy_short_2b: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B long_offset_short_repeat_as_copy_encodeBlockAsm8B: MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI + MOVW SI, 1(AX) + LEAL -60(BX), BX ADDQ $0x03, AX // emitRepeat - MOVL SI, DI - LEAL -4(SI), SI - CMPL DI, $0x08 + MOVL BX, SI + LEAL -4(BX), BX + CMPL SI, $0x08 JLE repeat_two_repeat_as_copy_encodeBlockAsm8B_emit_copy_short - CMPL DI, $0x0c + CMPL SI, $0x0c JGE cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short cant_repeat_two_offset_repeat_as_copy_encodeBlockAsm8B_emit_copy_short: - CMPL SI, $0x00000104 + CMPL BX, $0x00000104 JLT repeat_three_repeat_as_copy_encodeBlockAsm8B_emit_copy_short - LEAL -256(SI), SI + LEAL -256(BX), BX MOVW $0x0019, (AX) - MOVW SI, 2(AX) + MOVW BX, 2(AX) ADDQ $0x04, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_three_repeat_as_copy_encodeBlockAsm8B_emit_copy_short: - LEAL -4(SI), SI + LEAL -4(BX), BX MOVW $0x0015, (AX) - MOVB SI, 2(AX) + MOVB BL, 2(AX) ADDQ $0x03, AX JMP repeat_end_emit_encodeBlockAsm8B repeat_two_repeat_as_copy_encodeBlockAsm8B_emit_copy_short: - SHLL $0x02, SI - ORL $0x01, SI - MOVW SI, (AX) + SHLL $0x02, BX + ORL $0x01, BX + MOVW BX, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B - XORQ R8, R8 - LEAL 1(R8)(SI*4), SI - MOVB DI, 1(AX) - SARL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + XORQ DI, DI + LEAL 1(DI)(BX*4), BX + MOVB SI, 1(AX) + SARL $0x08, SI + SHLL $0x05, SI + ORL SI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B - JMP two_byte_offset_repeat_as_copy_encodeBlockAsm8B two_byte_offset_short_repeat_as_copy_encodeBlockAsm8B: - CMPL SI, $0x0c + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c JGE emit_copy_three_repeat_as_copy_encodeBlockAsm8B - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) ADDQ $0x02, AX JMP repeat_end_emit_encodeBlockAsm8B emit_copy_three_repeat_as_copy_encodeBlockAsm8B: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) ADDQ $0x03, AX repeat_end_emit_encodeBlockAsm8B: @@ -5186,16 +5152,16 @@ repeat_end_emit_encodeBlockAsm8B: JMP search_loop_encodeBlockAsm8B no_repeat_found_encodeBlockAsm8B: - CMPL (DX)(SI*1), DI + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBlockAsm8B - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI JEQ candidate2_match_encodeBlockAsm8B - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI JEQ candidate3_match_encodeBlockAsm8B MOVL 20(SP), CX JMP search_loop_encodeBlockAsm8B @@ -5205,381 +5171,379 @@ candidate3_match_encodeBlockAsm8B: JMP candidate_match_encodeBlockAsm8B candidate2_match_encodeBlockAsm8B: - MOVL R9, 24(SP)(R10*4) + MOVL R8, 24(SP)(R9*4) INCL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBlockAsm8B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBlockAsm8B match_extend_back_loop_encodeBlockAsm8B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBlockAsm8B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBlockAsm8B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBlockAsm8B JMP match_extend_back_loop_encodeBlockAsm8B match_extend_back_end_encodeBlockAsm8B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBlockAsm8B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBlockAsm8B: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI JEQ emit_literal_done_match_emit_encodeBlockAsm8B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c JLT one_byte_match_emit_encodeBlockAsm8B - CMPL R8, $0x00000100 + CMPL DI, $0x00000100 JLT two_bytes_match_emit_encodeBlockAsm8B MOVB $0xf4, (AX) - MOVW R8, 1(AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBlockAsm8B two_bytes_match_emit_encodeBlockAsm8B: MOVB $0xf0, (AX) - MOVB R8, 1(AX) + MOVB DI, 1(AX) ADDQ $0x02, AX - CMPL R8, $0x40 + CMPL DI, $0x40 JL memmove_match_emit_encodeBlockAsm8B JMP memmove_long_match_emit_encodeBlockAsm8B one_byte_match_emit_encodeBlockAsm8B: - SHLB $0x02, R8 - MOVB R8, (AX) + SHLB $0x02, DI + MOVB DI, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBlockAsm8B: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) + MOVQ (SI), R9 + MOVQ R9, (AX) JMP memmove_end_copy_match_emit_encodeBlockAsm8B emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm8B emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBlockAsm8B emit_lit_memmove_match_emit_encodeBlockAsm8B_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBlockAsm8B: - MOVQ R8, AX + MOVQ DI, AX JMP emit_literal_done_match_emit_encodeBlockAsm8B memmove_long_match_emit_encodeBlockAsm8B: - LEAQ (AX)(R9*1), R8 + LEAQ (AX)(R8*1), DI // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_match_emit_encodeBlockAsm8Blarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_match_emit_encodeBlockAsm8Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_match_emit_encodeBlockAsm8Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBlockAsm8Blarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 JAE emit_lit_memmove_long_match_emit_encodeBlockAsm8Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX emit_literal_done_match_emit_encodeBlockAsm8B: match_nolit_loop_encodeBlockAsm8B: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), DI - SUBL CX, DI - LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX // matchLen - XORL R10, R10 - CMPL DI, $0x08 + XORL R9, R9 + CMPL SI, $0x08 JL matchlen_match4_match_nolit_encodeBlockAsm8B matchlen_loopback_match_nolit_encodeBlockAsm8B: - MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 - TESTQ R9, R9 + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 JZ matchlen_loop_match_nolit_encodeBlockAsm8B #ifdef GOAMD64_v3 - TZCNTQ R9, R9 + TZCNTQ R8, R8 #else - BSFQ R9, R9 + BSFQ R8, R8 #endif - SARQ $0x03, R9 - LEAL (R10)(R9*1), R10 + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 JMP match_nolit_end_encodeBlockAsm8B matchlen_loop_match_nolit_encodeBlockAsm8B: - LEAL -8(DI), DI - LEAL 8(R10), R10 - CMPL DI, $0x08 + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeBlockAsm8B JZ match_nolit_end_encodeBlockAsm8B matchlen_match4_match_nolit_encodeBlockAsm8B: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeBlockAsm8B - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm8B - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm8B: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeBlockAsm8B - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm8B - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeBlockAsm8B: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeBlockAsm8B - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm8B - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeBlockAsm8B: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy -two_byte_offset_match_nolit_encodeBlockAsm8B: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeBlockAsm8B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JAE long_offset_short_match_nolit_encodeBlockAsm8B - MOVL $0x00000001, DI - LEAL 16(DI), DI - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, DI - MOVB DI, (AX) + MOVL $0x00000001, SI + LEAL 16(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX - SUBL $0x08, R10 + SUBL $0x08, R9 // emitRepeat - LEAL -4(R10), R10 + LEAL -4(R9), R9 JMP cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short_2b - MOVL R10, SI - LEAL -4(R10), R10 - CMPL SI, $0x08 + MOVL R9, BX + LEAL -4(R9), R9 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm8B_emit_copy_short_2b - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short_2b: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm8B_emit_copy_short_2b - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B repeat_three_match_nolit_encodeBlockAsm8B_emit_copy_short_2b: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B repeat_two_match_nolit_encodeBlockAsm8B_emit_copy_short_2b: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B long_offset_short_match_nolit_encodeBlockAsm8B: MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX // emitRepeat - MOVL R10, SI - LEAL -4(R10), R10 - CMPL SI, $0x08 + MOVL R9, BX + LEAL -4(R9), R9 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBlockAsm8B_emit_copy_short - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBlockAsm8B_emit_copy_short: - CMPL R10, $0x00000104 + CMPL R9, $0x00000104 JLT repeat_three_match_nolit_encodeBlockAsm8B_emit_copy_short - LEAL -256(R10), R10 + LEAL -256(R9), R9 MOVW $0x0019, (AX) - MOVW R10, 2(AX) + MOVW R9, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B repeat_three_match_nolit_encodeBlockAsm8B_emit_copy_short: - LEAL -4(R10), R10 + LEAL -4(R9), R9 MOVW $0x0015, (AX) - MOVB R10, 2(AX) + MOVB R9, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B repeat_two_match_nolit_encodeBlockAsm8B_emit_copy_short: - SHLL $0x02, R10 - ORL $0x01, R10 - MOVW R10, (AX) + SHLL $0x02, R9 + ORL $0x01, R9 + MOVW R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B - XORQ DI, DI - LEAL 1(DI)(R10*4), R10 - MOVB SI, 1(AX) - SARL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + XORQ SI, SI + LEAL 1(SI)(R9*4), R9 + MOVB BL, 1(AX) + SARL $0x08, BX + SHLL $0x05, BX + ORL BX, R9 + MOVB R9, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B - JMP two_byte_offset_match_nolit_encodeBlockAsm8B two_byte_offset_short_match_nolit_encodeBlockAsm8B: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeBlockAsm8B - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBlockAsm8B emit_copy_three_match_nolit_encodeBlockAsm8B: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeBlockAsm8B: CMPL CX, 8(SP) JGE emit_remainder_encodeBlockAsm8B - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeBlockAsm8B MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeBlockAsm8B: - MOVQ $0x9e3779b1, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x20, R8 - IMULQ R9, R8 - SHRQ $0x38, R8 - SHLQ $0x20, SI - IMULQ R9, SI - SHRQ $0x38, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x9e3779b1, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x20, DI + IMULQ R8, DI + SHRQ $0x38, DI + SHLQ $0x20, BX + IMULQ R8, BX + SHRQ $0x38, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeBlockAsm8B INCL CX JMP search_loop_encodeBlockAsm8B @@ -5743,9 +5707,9 @@ emit_literal_done_emit_remainder_encodeBlockAsm8B: // func encodeBetterBlockAsm(dst []byte, src []byte) int // Requires: BMI, SSE2 -TEXT ·encodeBetterBlockAsm(SB), $327704-56 +TEXT ·encodeBetterBlockAsm(SB), $589848-56 MOVQ dst_base+0(FP), AX - MOVQ $0x00000a00, CX + MOVQ $0x00001200, CX LEAQ 24(SP), DX PXOR X0, X0 @@ -5764,8 +5728,8 @@ zero_loop_encodeBetterBlockAsm: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -6(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -5775,808 +5739,810 @@ zero_loop_encodeBetterBlockAsm: MOVQ src_base+24(FP), DX search_loop_encodeBetterBlockAsm: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x07, SI - CMPL SI, $0x63 + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x07, BX + CMPL BX, $0x63 JLE check_maxskip_ok_encodeBetterBlockAsm - LEAL 100(CX), SI + LEAL 100(CX), BX JMP check_maxskip_cont_encodeBetterBlockAsm check_maxskip_ok_encodeBetterBlockAsm: - LEAL 1(CX)(SI*1), SI + LEAL 1(CX)(BX*1), BX check_maxskip_cont_encodeBetterBlockAsm: - CMPL SI, 8(SP) + CMPL BX, 8(SP) JGE emit_remainder_encodeBetterBlockAsm - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x00cf1bbcdcbfa563, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 262168(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 262168(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x00cf1bbcdcbfa563, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x2f, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x32, R10 + MOVL 24(SP)(R9*4), BX + MOVL 524312(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 524312(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeBetterBlockAsm - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeBetterBlockAsm - MOVL 20(SP), CX - JMP search_loop_encodeBetterBlockAsm + CMPQ R10, SI + JNE no_short_found_encodeBetterBlockAsm + MOVL DI, BX + JMP candidate_match_encodeBetterBlockAsm + +no_short_found_encodeBetterBlockAsm: + CMPL R9, SI + JEQ candidate_match_encodeBetterBlockAsm + CMPL R10, SI + JEQ candidateS_match_encodeBetterBlockAsm + MOVL 20(SP), CX + JMP search_loop_encodeBetterBlockAsm candidateS_match_encodeBetterBlockAsm: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x2f, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBetterBlockAsm DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBetterBlockAsm: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBetterBlockAsm match_extend_back_loop_encodeBetterBlockAsm: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBetterBlockAsm - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBetterBlockAsm LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBetterBlockAsm JMP match_extend_back_loop_encodeBetterBlockAsm match_extend_back_end_encodeBetterBlockAsm: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 5(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 5(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBetterBlockAsm MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBetterBlockAsm: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeBetterBlockAsm matchlen_loopback_match_nolit_encodeBetterBlockAsm: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeBetterBlockAsm #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeBetterBlockAsm matchlen_loop_match_nolit_encodeBetterBlockAsm: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeBetterBlockAsm JZ match_nolit_end_encodeBetterBlockAsm matchlen_match4_match_nolit_encodeBetterBlockAsm: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeBetterBlockAsm - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeBetterBlockAsm - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeBetterBlockAsm: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeBetterBlockAsm - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeBetterBlockAsm: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - CMPL 16(SP), R8 + CMPL 16(SP), DI JEQ match_is_repeat_encodeBetterBlockAsm - CMPL R12, $0x01 + CMPL R11, $0x01 JG match_length_ok_encodeBetterBlockAsm - CMPL R8, $0x0000ffff + CMPL DI, $0x0000ffff JLE match_length_ok_encodeBetterBlockAsm MOVL 20(SP), CX INCL CX JMP search_loop_encodeBetterBlockAsm match_length_ok_encodeBetterBlockAsm: - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeBetterBlockAsm - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeBetterBlockAsm - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeBetterBlockAsm - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_match_emit_encodeBetterBlockAsm - CMPL SI, $0x01000000 + CMPL BX, $0x01000000 JLT four_bytes_match_emit_encodeBetterBlockAsm MOVB $0xfc, (AX) - MOVL SI, 1(AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP memmove_long_match_emit_encodeBetterBlockAsm four_bytes_match_emit_encodeBetterBlockAsm: - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_match_emit_encodeBetterBlockAsm three_bytes_match_emit_encodeBetterBlockAsm: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBetterBlockAsm two_bytes_match_emit_encodeBetterBlockAsm: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeBetterBlockAsm JMP memmove_long_match_emit_encodeBetterBlockAsm one_byte_match_emit_encodeBetterBlockAsm: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBetterBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm emit_lit_memmove_match_emit_encodeBetterBlockAsm_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBetterBlockAsm: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeBetterBlockAsm memmove_long_match_emit_encodeBetterBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeBetterBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeBetterBlockAsmlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeBetterBlockAsmlarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBetterBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeBetterBlockAsmlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeBetterBlockAsm: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy - CMPL R8, $0x00010000 + CMPL DI, $0x00010000 JL two_byte_offset_match_nolit_encodeBetterBlockAsm - -four_bytes_loop_back_match_nolit_encodeBetterBlockAsm: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE four_bytes_remain_match_nolit_encodeBetterBlockAsm MOVB $0xff, (AX) - MOVL R8, 1(AX) - LEAL -64(R12), R12 + MOVL DI, 1(AX) + LEAL -64(R11), R11 ADDQ $0x05, AX - CMPL R12, $0x04 + CMPL R11, $0x04 JL four_bytes_remain_match_nolit_encodeBetterBlockAsm // emitRepeat emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy: - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy - CMPL R12, $0x0100ffff + CMPL R11, $0x0100ffff JLT repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy - LEAL -16842747(R12), R12 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + LEAL -16842747(R11), R11 + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX JMP emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy: - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm - JMP four_bytes_loop_back_match_nolit_encodeBetterBlockAsm four_bytes_remain_match_nolit_encodeBetterBlockAsm: - TESTL R12, R12 + TESTL R11, R11 JZ match_nolit_emitcopy_end_encodeBetterBlockAsm - MOVB $0x03, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVL R8, 1(AX) + XORL BX, BX + LEAL -1(BX)(R11*4), R11 + MOVB R11, (AX) + MOVL DI, 1(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm two_byte_offset_match_nolit_encodeBetterBlockAsm: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JAE long_offset_short_match_nolit_encodeBetterBlockAsm - MOVL $0x00000001, SI - LEAL 16(SI), SI - MOVB R8, 1(AX) - MOVL R8, R9 - SHRL $0x08, R9 - SHLL $0x05, R9 - ORL R9, SI - MOVB SI, (AX) + MOVL $0x00000001, BX + LEAL 16(BX), BX + MOVB DI, 1(AX) + MOVL DI, R8 + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, BX + MOVB BL, (AX) ADDQ $0x02, AX - SUBL $0x08, R12 + SUBL $0x08, R11 // emitRepeat - LEAL -4(R12), R12 + LEAL -4(R11), R11 JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b - CMPL R12, $0x0100ffff + CMPL R11, $0x0100ffff JLT repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b - LEAL -16842747(R12), R12 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + LEAL -16842747(R11), R11 + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX JMP emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short_2b: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm long_offset_short_match_nolit_encodeBetterBlockAsm: MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX // emitRepeat emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy_short: - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy_short - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy_short - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy_short - CMPL R12, $0x0100ffff + CMPL R11, $0x0100ffff JLT repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy_short - LEAL -16842747(R12), R12 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + LEAL -16842747(R11), R11 + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX JMP emit_repeat_again_match_nolit_encodeBetterBlockAsm_emit_copy_short repeat_five_match_nolit_encodeBetterBlockAsm_emit_copy_short: - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_four_match_nolit_encodeBetterBlockAsm_emit_copy_short: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_three_match_nolit_encodeBetterBlockAsm_emit_copy_short: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_match_nolit_encodeBetterBlockAsm_emit_copy_short: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_offset_match_nolit_encodeBetterBlockAsm_emit_copy_short: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm - JMP two_byte_offset_match_nolit_encodeBetterBlockAsm two_byte_offset_short_match_nolit_encodeBetterBlockAsm: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeBetterBlockAsm - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeBetterBlockAsm - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm emit_copy_three_match_nolit_encodeBetterBlockAsm: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm match_is_repeat_encodeBetterBlockAsm: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_repeat_encodeBetterBlockAsm - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_repeat_encodeBetterBlockAsm - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_repeat_encodeBetterBlockAsm - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_match_emit_repeat_encodeBetterBlockAsm - CMPL SI, $0x01000000 + CMPL BX, $0x01000000 JLT four_bytes_match_emit_repeat_encodeBetterBlockAsm MOVB $0xfc, (AX) - MOVL SI, 1(AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm four_bytes_match_emit_repeat_encodeBetterBlockAsm: - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm three_bytes_match_emit_repeat_encodeBetterBlockAsm: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm two_bytes_match_emit_repeat_encodeBetterBlockAsm: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_repeat_encodeBetterBlockAsm JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm one_byte_match_emit_repeat_encodeBetterBlockAsm: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_repeat_encodeBetterBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_33through64 emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_repeat_encodeBetterBlockAsm memmove_long_match_emit_repeat_encodeBetterBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsmlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsmlarge_big_loop_back emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsmlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_repeat_encodeBetterBlockAsm: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitRepeat emit_repeat_again_match_nolit_repeat_encodeBetterBlockAsm: - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_repeat_encodeBetterBlockAsm - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_repeat_encodeBetterBlockAsm - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_repeat_encodeBetterBlockAsm - CMPL R12, $0x0100ffff + CMPL R11, $0x0100ffff JLT repeat_five_match_nolit_repeat_encodeBetterBlockAsm - LEAL -16842747(R12), R12 - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + LEAL -16842747(R11), R11 + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX JMP emit_repeat_again_match_nolit_repeat_encodeBetterBlockAsm repeat_five_match_nolit_repeat_encodeBetterBlockAsm: - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_four_match_nolit_repeat_encodeBetterBlockAsm: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_three_match_nolit_repeat_encodeBetterBlockAsm: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_match_nolit_repeat_encodeBetterBlockAsm: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX match_nolit_emitcopy_end_encodeBetterBlockAsm: @@ -6588,54 +6554,51 @@ match_nolit_emitcopy_end_encodeBetterBlockAsm: RET match_nolit_dst_ok_encodeBetterBlockAsm: - MOVQ $0x00cf1bbcdcbfa563, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 + MOVQ $0x00cf1bbcdcbfa563, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x2f, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x32, R10 + SHLQ $0x08, R11 + IMULQ BX, R11 + SHRQ $0x2f, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x32, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 262168(SP)(R11*4) - MOVL R15, 262168(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 262168(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeBetterBlockAsm + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 524312(SP)(R10*4) + MOVL R13, 524312(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeBetterBlockAsm: + CMPQ SI, R8 + JAE search_loop_encodeBetterBlockAsm + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x08, DI + IMULQ BX, DI + SHRQ $0x2f, DI + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x2f, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeBetterBlockAsm emit_remainder_encodeBetterBlockAsm: MOVQ src_len+32(FP), CX @@ -6815,9 +6778,9 @@ emit_literal_done_emit_remainder_encodeBetterBlockAsm: // func encodeBetterBlockAsm4MB(dst []byte, src []byte) int // Requires: BMI, SSE2 -TEXT ·encodeBetterBlockAsm4MB(SB), $327704-56 +TEXT ·encodeBetterBlockAsm4MB(SB), $589848-56 MOVQ dst_base+0(FP), AX - MOVQ $0x00000a00, CX + MOVQ $0x00001200, CX LEAQ 24(SP), DX PXOR X0, X0 @@ -6836,8 +6799,8 @@ zero_loop_encodeBetterBlockAsm4MB: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -6(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -6847,746 +6810,752 @@ zero_loop_encodeBetterBlockAsm4MB: MOVQ src_base+24(FP), DX search_loop_encodeBetterBlockAsm4MB: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x07, SI - CMPL SI, $0x63 + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x07, BX + CMPL BX, $0x63 JLE check_maxskip_ok_encodeBetterBlockAsm4MB - LEAL 100(CX), SI + LEAL 100(CX), BX JMP check_maxskip_cont_encodeBetterBlockAsm4MB check_maxskip_ok_encodeBetterBlockAsm4MB: - LEAL 1(CX)(SI*1), SI + LEAL 1(CX)(BX*1), BX check_maxskip_cont_encodeBetterBlockAsm4MB: - CMPL SI, 8(SP) + CMPL BX, 8(SP) JGE emit_remainder_encodeBetterBlockAsm4MB - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x00cf1bbcdcbfa563, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 262168(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 262168(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x00cf1bbcdcbfa563, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x2f, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x32, R10 + MOVL 24(SP)(R9*4), BX + MOVL 524312(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 524312(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeBetterBlockAsm4MB - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeBetterBlockAsm4MB - MOVL 20(SP), CX - JMP search_loop_encodeBetterBlockAsm4MB + CMPQ R10, SI + JNE no_short_found_encodeBetterBlockAsm4MB + MOVL DI, BX + JMP candidate_match_encodeBetterBlockAsm4MB + +no_short_found_encodeBetterBlockAsm4MB: + CMPL R9, SI + JEQ candidate_match_encodeBetterBlockAsm4MB + CMPL R10, SI + JEQ candidateS_match_encodeBetterBlockAsm4MB + MOVL 20(SP), CX + JMP search_loop_encodeBetterBlockAsm4MB candidateS_match_encodeBetterBlockAsm4MB: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x2f, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBetterBlockAsm4MB DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBetterBlockAsm4MB: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBetterBlockAsm4MB match_extend_back_loop_encodeBetterBlockAsm4MB: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBetterBlockAsm4MB - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBetterBlockAsm4MB LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBetterBlockAsm4MB JMP match_extend_back_loop_encodeBetterBlockAsm4MB match_extend_back_end_encodeBetterBlockAsm4MB: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 4(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 4(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBetterBlockAsm4MB MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBetterBlockAsm4MB: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeBetterBlockAsm4MB matchlen_loopback_match_nolit_encodeBetterBlockAsm4MB: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeBetterBlockAsm4MB #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeBetterBlockAsm4MB matchlen_loop_match_nolit_encodeBetterBlockAsm4MB: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeBetterBlockAsm4MB JZ match_nolit_end_encodeBetterBlockAsm4MB matchlen_match4_match_nolit_encodeBetterBlockAsm4MB: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeBetterBlockAsm4MB - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm4MB - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm4MB: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeBetterBlockAsm4MB - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm4MB - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeBetterBlockAsm4MB: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeBetterBlockAsm4MB - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm4MB - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeBetterBlockAsm4MB: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - CMPL 16(SP), R8 + CMPL 16(SP), DI JEQ match_is_repeat_encodeBetterBlockAsm4MB - CMPL R12, $0x01 + CMPL R11, $0x01 JG match_length_ok_encodeBetterBlockAsm4MB - CMPL R8, $0x0000ffff + CMPL DI, $0x0000ffff JLE match_length_ok_encodeBetterBlockAsm4MB MOVL 20(SP), CX INCL CX JMP search_loop_encodeBetterBlockAsm4MB match_length_ok_encodeBetterBlockAsm4MB: - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeBetterBlockAsm4MB - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeBetterBlockAsm4MB - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeBetterBlockAsm4MB - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_match_emit_encodeBetterBlockAsm4MB - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_match_emit_encodeBetterBlockAsm4MB three_bytes_match_emit_encodeBetterBlockAsm4MB: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBetterBlockAsm4MB two_bytes_match_emit_encodeBetterBlockAsm4MB: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeBetterBlockAsm4MB JMP memmove_long_match_emit_encodeBetterBlockAsm4MB one_byte_match_emit_encodeBetterBlockAsm4MB: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBetterBlockAsm4MB: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_encodeBetterBlockAsm4MB_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBetterBlockAsm4MB: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeBetterBlockAsm4MB memmove_long_match_emit_encodeBetterBlockAsm4MB: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm4MBlarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeBetterBlockAsm4MBlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm4MBlarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBetterBlockAsm4MBlarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeBetterBlockAsm4MBlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeBetterBlockAsm4MB: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy - CMPL R8, $0x00010000 + CMPL DI, $0x00010000 JL two_byte_offset_match_nolit_encodeBetterBlockAsm4MB - -four_bytes_loop_back_match_nolit_encodeBetterBlockAsm4MB: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE four_bytes_remain_match_nolit_encodeBetterBlockAsm4MB MOVB $0xff, (AX) - MOVL R8, 1(AX) - LEAL -64(R12), R12 + MOVL DI, 1(AX) + LEAL -64(R11), R11 ADDQ $0x05, AX - CMPL R12, $0x04 + CMPL R11, $0x04 JL four_bytes_remain_match_nolit_encodeBetterBlockAsm4MB // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB - JMP four_bytes_loop_back_match_nolit_encodeBetterBlockAsm4MB four_bytes_remain_match_nolit_encodeBetterBlockAsm4MB: - TESTL R12, R12 + TESTL R11, R11 JZ match_nolit_emitcopy_end_encodeBetterBlockAsm4MB - MOVB $0x03, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVL R8, 1(AX) + XORL BX, BX + LEAL -1(BX)(R11*4), R11 + MOVB R11, (AX) + MOVL DI, 1(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB two_byte_offset_match_nolit_encodeBetterBlockAsm4MB: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm4MB - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JAE long_offset_short_match_nolit_encodeBetterBlockAsm4MB - MOVL $0x00000001, SI - LEAL 16(SI), SI - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, SI - MOVB SI, (AX) + MOVL $0x00000001, BX + LEAL 16(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX - SUBL $0x08, R12 + SUBL $0x08, R11 // emitRepeat - LEAL -4(R12), R12 + LEAL -4(R11), R11 JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short_2b: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB long_offset_short_match_nolit_encodeBetterBlockAsm4MB: MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_four_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_three_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_offset_match_nolit_encodeBetterBlockAsm4MB_emit_copy_short: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB - JMP two_byte_offset_match_nolit_encodeBetterBlockAsm4MB two_byte_offset_short_match_nolit_encodeBetterBlockAsm4MB: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeBetterBlockAsm4MB - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeBetterBlockAsm4MB - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB emit_copy_three_match_nolit_encodeBetterBlockAsm4MB: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB match_is_repeat_encodeBetterBlockAsm4MB: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_repeat_encodeBetterBlockAsm4MB - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_repeat_encodeBetterBlockAsm4MB - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_repeat_encodeBetterBlockAsm4MB - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_match_emit_repeat_encodeBetterBlockAsm4MB - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm4MB three_bytes_match_emit_repeat_encodeBetterBlockAsm4MB: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm4MB two_bytes_match_emit_repeat_encodeBetterBlockAsm4MB: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_repeat_encodeBetterBlockAsm4MB JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm4MB one_byte_match_emit_repeat_encodeBetterBlockAsm4MB: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_repeat_encodeBetterBlockAsm4MB: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_17through32 JMP emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_33through64 emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm4MB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm4MB_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm4MB: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_repeat_encodeBetterBlockAsm4MB memmove_long_match_emit_repeat_encodeBetterBlockAsm4MB: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm4MBlarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm4MBlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm4MBlarge_big_loop_back emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm4MBlarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm4MBlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_repeat_encodeBetterBlockAsm4MB: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_repeat_encodeBetterBlockAsm4MB - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm4MB - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm4MB cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm4MB: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_repeat_encodeBetterBlockAsm4MB - CMPL R12, $0x00010100 + CMPL R11, $0x00010100 JLT repeat_four_match_nolit_repeat_encodeBetterBlockAsm4MB - LEAL -65536(R12), R12 - MOVL R12, R8 + LEAL -65536(R11), R11 + MOVL R11, DI MOVW $0x001d, (AX) - MOVW R12, 2(AX) - SARL $0x10, R8 - MOVB R8, 4(AX) + MOVW R11, 2(AX) + SARL $0x10, DI + MOVB DI, 4(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_four_match_nolit_repeat_encodeBetterBlockAsm4MB: - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_three_match_nolit_repeat_encodeBetterBlockAsm4MB: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_match_nolit_repeat_encodeBetterBlockAsm4MB: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm4MB repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm4MB: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX match_nolit_emitcopy_end_encodeBetterBlockAsm4MB: @@ -7598,54 +7567,51 @@ match_nolit_emitcopy_end_encodeBetterBlockAsm4MB: RET match_nolit_dst_ok_encodeBetterBlockAsm4MB: - MOVQ $0x00cf1bbcdcbfa563, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 + MOVQ $0x00cf1bbcdcbfa563, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x2f, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x32, R10 + SHLQ $0x08, R11 + IMULQ BX, R11 + SHRQ $0x2f, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x32, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 262168(SP)(R11*4) - MOVL R15, 262168(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 262168(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeBetterBlockAsm4MB + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 524312(SP)(R10*4) + MOVL R13, 524312(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeBetterBlockAsm4MB: + CMPQ SI, R8 + JAE search_loop_encodeBetterBlockAsm4MB + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x08, DI + IMULQ BX, DI + SHRQ $0x2f, DI + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x2f, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeBetterBlockAsm4MB emit_remainder_encodeBetterBlockAsm4MB: MOVQ src_len+32(FP), CX @@ -7838,8 +7804,8 @@ zero_loop_encodeBetterBlockAsm12B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -6(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -7849,591 +7815,599 @@ zero_loop_encodeBetterBlockAsm12B: MOVQ src_base+24(FP), DX search_loop_encodeBetterBlockAsm12B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x06, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x06, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBetterBlockAsm12B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x34, R11 - MOVL 24(SP)(R10*4), SI - MOVL 65560(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 65560(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x34, R10 + MOVL 24(SP)(R9*4), BX + MOVL 65560(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 65560(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeBetterBlockAsm12B - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeBetterBlockAsm12B - MOVL 20(SP), CX - JMP search_loop_encodeBetterBlockAsm12B + CMPQ R10, SI + JNE no_short_found_encodeBetterBlockAsm12B + MOVL DI, BX + JMP candidate_match_encodeBetterBlockAsm12B + +no_short_found_encodeBetterBlockAsm12B: + CMPL R9, SI + JEQ candidate_match_encodeBetterBlockAsm12B + CMPL R10, SI + JEQ candidateS_match_encodeBetterBlockAsm12B + MOVL 20(SP), CX + JMP search_loop_encodeBetterBlockAsm12B candidateS_match_encodeBetterBlockAsm12B: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBetterBlockAsm12B DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBetterBlockAsm12B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBetterBlockAsm12B match_extend_back_loop_encodeBetterBlockAsm12B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBetterBlockAsm12B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBetterBlockAsm12B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBetterBlockAsm12B JMP match_extend_back_loop_encodeBetterBlockAsm12B match_extend_back_end_encodeBetterBlockAsm12B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBetterBlockAsm12B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBetterBlockAsm12B: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeBetterBlockAsm12B matchlen_loopback_match_nolit_encodeBetterBlockAsm12B: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeBetterBlockAsm12B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeBetterBlockAsm12B matchlen_loop_match_nolit_encodeBetterBlockAsm12B: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeBetterBlockAsm12B JZ match_nolit_end_encodeBetterBlockAsm12B matchlen_match4_match_nolit_encodeBetterBlockAsm12B: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeBetterBlockAsm12B - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm12B - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm12B: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeBetterBlockAsm12B - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm12B - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeBetterBlockAsm12B: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeBetterBlockAsm12B - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm12B - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeBetterBlockAsm12B: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - CMPL 16(SP), R8 + CMPL 16(SP), DI JEQ match_is_repeat_encodeBetterBlockAsm12B - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeBetterBlockAsm12B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeBetterBlockAsm12B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeBetterBlockAsm12B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBetterBlockAsm12B two_bytes_match_emit_encodeBetterBlockAsm12B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeBetterBlockAsm12B JMP memmove_long_match_emit_encodeBetterBlockAsm12B one_byte_match_emit_encodeBetterBlockAsm12B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBetterBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_encodeBetterBlockAsm12B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBetterBlockAsm12B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeBetterBlockAsm12B memmove_long_match_emit_encodeBetterBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeBetterBlockAsm12Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm12Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBetterBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeBetterBlockAsm12Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeBetterBlockAsm12B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy -two_byte_offset_match_nolit_encodeBetterBlockAsm12B: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm12B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JAE long_offset_short_match_nolit_encodeBetterBlockAsm12B - MOVL $0x00000001, SI - LEAL 16(SI), SI - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, SI - MOVB SI, (AX) + MOVL $0x00000001, BX + LEAL 16(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX - SUBL $0x08, R12 + SUBL $0x08, R11 // emitRepeat - LEAL -4(R12), R12 + LEAL -4(R11), R11 JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_three_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_two_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short_2b: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B long_offset_short_match_nolit_encodeBetterBlockAsm12B: MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm12B_emit_copy_short - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm12B_emit_copy_short - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_three_match_nolit_encodeBetterBlockAsm12B_emit_copy_short: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_two_match_nolit_encodeBetterBlockAsm12B_emit_copy_short: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_two_offset_match_nolit_encodeBetterBlockAsm12B_emit_copy_short: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B - JMP two_byte_offset_match_nolit_encodeBetterBlockAsm12B two_byte_offset_short_match_nolit_encodeBetterBlockAsm12B: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeBetterBlockAsm12B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeBetterBlockAsm12B - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B emit_copy_three_match_nolit_encodeBetterBlockAsm12B: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B match_is_repeat_encodeBetterBlockAsm12B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_repeat_encodeBetterBlockAsm12B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_repeat_encodeBetterBlockAsm12B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_repeat_encodeBetterBlockAsm12B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm12B two_bytes_match_emit_repeat_encodeBetterBlockAsm12B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_repeat_encodeBetterBlockAsm12B JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm12B one_byte_match_emit_repeat_encodeBetterBlockAsm12B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_repeat_encodeBetterBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_33through64 emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm12B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm12B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm12B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_repeat_encodeBetterBlockAsm12B memmove_long_match_emit_repeat_encodeBetterBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm12Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm12Blarge_big_loop_back emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm12Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_repeat_encodeBetterBlockAsm12B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_repeat_encodeBetterBlockAsm12B - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm12B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm12B cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm12B: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_repeat_encodeBetterBlockAsm12B - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_three_match_nolit_repeat_encodeBetterBlockAsm12B: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_two_match_nolit_repeat_encodeBetterBlockAsm12B: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm12B repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm12B: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX match_nolit_emitcopy_end_encodeBetterBlockAsm12B: @@ -8445,54 +8419,51 @@ match_nolit_emitcopy_end_encodeBetterBlockAsm12B: RET match_nolit_dst_ok_encodeBetterBlockAsm12B: - MOVQ $0x0000cf1bbcdcbf9b, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x32, R10 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x32, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x34, R11 + MOVQ $0x0000cf1bbcdcbf9b, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x32, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x34, R10 + SHLQ $0x10, R11 + IMULQ BX, R11 + SHRQ $0x32, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x34, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 65560(SP)(R11*4) - MOVL R15, 65560(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x32, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x34, R11 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x32, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 65560(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeBetterBlockAsm12B + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 65560(SP)(R10*4) + MOVL R13, 65560(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeBetterBlockAsm12B: + CMPQ SI, R8 + JAE search_loop_encodeBetterBlockAsm12B + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x10, DI + IMULQ BX, DI + SHRQ $0x32, DI + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x32, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeBetterBlockAsm12B emit_remainder_encodeBetterBlockAsm12B: MOVQ src_len+32(FP), CX @@ -8674,8 +8645,8 @@ zero_loop_encodeBetterBlockAsm10B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -6(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -8685,591 +8656,599 @@ zero_loop_encodeBetterBlockAsm10B: MOVQ src_base+24(FP), DX search_loop_encodeBetterBlockAsm10B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x05, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBetterBlockAsm10B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x34, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x36, R11 - MOVL 24(SP)(R10*4), SI - MOVL 16408(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 16408(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x36, R10 + MOVL 24(SP)(R9*4), BX + MOVL 16408(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 16408(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeBetterBlockAsm10B - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeBetterBlockAsm10B - MOVL 20(SP), CX - JMP search_loop_encodeBetterBlockAsm10B + CMPQ R10, SI + JNE no_short_found_encodeBetterBlockAsm10B + MOVL DI, BX + JMP candidate_match_encodeBetterBlockAsm10B + +no_short_found_encodeBetterBlockAsm10B: + CMPL R9, SI + JEQ candidate_match_encodeBetterBlockAsm10B + CMPL R10, SI + JEQ candidateS_match_encodeBetterBlockAsm10B + MOVL 20(SP), CX + JMP search_loop_encodeBetterBlockAsm10B candidateS_match_encodeBetterBlockAsm10B: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x34, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBetterBlockAsm10B DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBetterBlockAsm10B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBetterBlockAsm10B match_extend_back_loop_encodeBetterBlockAsm10B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBetterBlockAsm10B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBetterBlockAsm10B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBetterBlockAsm10B JMP match_extend_back_loop_encodeBetterBlockAsm10B match_extend_back_end_encodeBetterBlockAsm10B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBetterBlockAsm10B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBetterBlockAsm10B: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeBetterBlockAsm10B matchlen_loopback_match_nolit_encodeBetterBlockAsm10B: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeBetterBlockAsm10B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeBetterBlockAsm10B matchlen_loop_match_nolit_encodeBetterBlockAsm10B: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeBetterBlockAsm10B JZ match_nolit_end_encodeBetterBlockAsm10B matchlen_match4_match_nolit_encodeBetterBlockAsm10B: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeBetterBlockAsm10B - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm10B - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm10B: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeBetterBlockAsm10B - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm10B - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeBetterBlockAsm10B: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeBetterBlockAsm10B - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm10B - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeBetterBlockAsm10B: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - CMPL 16(SP), R8 + CMPL 16(SP), DI JEQ match_is_repeat_encodeBetterBlockAsm10B - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeBetterBlockAsm10B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeBetterBlockAsm10B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeBetterBlockAsm10B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBetterBlockAsm10B two_bytes_match_emit_encodeBetterBlockAsm10B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeBetterBlockAsm10B JMP memmove_long_match_emit_encodeBetterBlockAsm10B one_byte_match_emit_encodeBetterBlockAsm10B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBetterBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_encodeBetterBlockAsm10B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeBetterBlockAsm10B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeBetterBlockAsm10B memmove_long_match_emit_encodeBetterBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeBetterBlockAsm10Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm10Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeBetterBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeBetterBlockAsm10Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeBetterBlockAsm10B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy -two_byte_offset_match_nolit_encodeBetterBlockAsm10B: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm10B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JAE long_offset_short_match_nolit_encodeBetterBlockAsm10B - MOVL $0x00000001, SI - LEAL 16(SI), SI - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, SI - MOVB SI, (AX) + MOVL $0x00000001, BX + LEAL 16(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX - SUBL $0x08, R12 + SUBL $0x08, R11 // emitRepeat - LEAL -4(R12), R12 + LEAL -4(R11), R11 JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_three_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_two_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short_2b: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B long_offset_short_match_nolit_encodeBetterBlockAsm10B: MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_encodeBetterBlockAsm10B_emit_copy_short - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_encodeBetterBlockAsm10B_emit_copy_short - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_three_match_nolit_encodeBetterBlockAsm10B_emit_copy_short: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_two_match_nolit_encodeBetterBlockAsm10B_emit_copy_short: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_two_offset_match_nolit_encodeBetterBlockAsm10B_emit_copy_short: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B - JMP two_byte_offset_match_nolit_encodeBetterBlockAsm10B two_byte_offset_short_match_nolit_encodeBetterBlockAsm10B: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeBetterBlockAsm10B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeBetterBlockAsm10B - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B emit_copy_three_match_nolit_encodeBetterBlockAsm10B: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B match_is_repeat_encodeBetterBlockAsm10B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_repeat_encodeBetterBlockAsm10B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_repeat_encodeBetterBlockAsm10B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_repeat_encodeBetterBlockAsm10B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm10B two_bytes_match_emit_repeat_encodeBetterBlockAsm10B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_repeat_encodeBetterBlockAsm10B JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm10B one_byte_match_emit_repeat_encodeBetterBlockAsm10B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_repeat_encodeBetterBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_33through64 emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) + MOVL (R9), R10 + MOVL -4(R9)(R8*1), R9 + MOVL R10, (AX) + MOVL R9, -4(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm10B emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm10B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm10B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_repeat_encodeBetterBlockAsm10B memmove_long_match_emit_repeat_encodeBetterBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm10Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm10Blarge_big_loop_back emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm10Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_repeat_encodeBetterBlockAsm10B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_repeat_encodeBetterBlockAsm10B - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm10B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JLT repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm10B cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm10B: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_repeat_encodeBetterBlockAsm10B - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_three_match_nolit_repeat_encodeBetterBlockAsm10B: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_two_match_nolit_repeat_encodeBetterBlockAsm10B: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm10B repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm10B: - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX match_nolit_emitcopy_end_encodeBetterBlockAsm10B: @@ -9281,54 +9260,51 @@ match_nolit_emitcopy_end_encodeBetterBlockAsm10B: RET match_nolit_dst_ok_encodeBetterBlockAsm10B: - MOVQ $0x0000cf1bbcdcbf9b, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x34, R10 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x34, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x36, R11 + MOVQ $0x0000cf1bbcdcbf9b, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x34, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x36, R10 + SHLQ $0x10, R11 + IMULQ BX, R11 + SHRQ $0x34, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x36, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 16408(SP)(R11*4) - MOVL R15, 16408(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x34, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x36, R11 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x34, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 16408(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeBetterBlockAsm10B + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 16408(SP)(R10*4) + MOVL R13, 16408(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeBetterBlockAsm10B: + CMPQ SI, R8 + JAE search_loop_encodeBetterBlockAsm10B + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x10, DI + IMULQ BX, DI + SHRQ $0x34, DI + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x34, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeBetterBlockAsm10B emit_remainder_encodeBetterBlockAsm10B: MOVQ src_len+32(FP), CX @@ -9510,8 +9486,8 @@ zero_loop_encodeBetterBlockAsm8B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -6(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -9521,478 +9497,228 @@ zero_loop_encodeBetterBlockAsm8B: MOVQ src_base+24(FP), DX search_loop_encodeBetterBlockAsm8B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x04, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x04, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeBetterBlockAsm8B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x36, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x38, R11 - MOVL 24(SP)(R10*4), SI - MOVL 4120(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 4120(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x38, R10 + MOVL 24(SP)(R9*4), BX + MOVL 4120(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 4120(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeBetterBlockAsm8B - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeBetterBlockAsm8B - MOVL 20(SP), CX - JMP search_loop_encodeBetterBlockAsm8B + CMPQ R10, SI + JNE no_short_found_encodeBetterBlockAsm8B + MOVL DI, BX + JMP candidate_match_encodeBetterBlockAsm8B + +no_short_found_encodeBetterBlockAsm8B: + CMPL R9, SI + JEQ candidate_match_encodeBetterBlockAsm8B + CMPL R10, SI + JEQ candidateS_match_encodeBetterBlockAsm8B + MOVL 20(SP), CX + JMP search_loop_encodeBetterBlockAsm8B candidateS_match_encodeBetterBlockAsm8B: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x36, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeBetterBlockAsm8B DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeBetterBlockAsm8B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeBetterBlockAsm8B match_extend_back_loop_encodeBetterBlockAsm8B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeBetterBlockAsm8B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeBetterBlockAsm8B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeBetterBlockAsm8B JMP match_extend_back_loop_encodeBetterBlockAsm8B match_extend_back_end_encodeBetterBlockAsm8B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeBetterBlockAsm8B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeBetterBlockAsm8B: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeBetterBlockAsm8B matchlen_loopback_match_nolit_encodeBetterBlockAsm8B: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeBetterBlockAsm8B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeBetterBlockAsm8B matchlen_loop_match_nolit_encodeBetterBlockAsm8B: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeBetterBlockAsm8B JZ match_nolit_end_encodeBetterBlockAsm8B matchlen_match4_match_nolit_encodeBetterBlockAsm8B: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeBetterBlockAsm8B - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm8B - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm8B: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeBetterBlockAsm8B - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm8B - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeBetterBlockAsm8B: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeBetterBlockAsm8B - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm8B - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeBetterBlockAsm8B: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - CMPL 16(SP), R8 + CMPL 16(SP), DI JEQ match_is_repeat_encodeBetterBlockAsm8B - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeBetterBlockAsm8B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeBetterBlockAsm8B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeBetterBlockAsm8B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeBetterBlockAsm8B two_bytes_match_emit_encodeBetterBlockAsm8B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeBetterBlockAsm8B JMP memmove_long_match_emit_encodeBetterBlockAsm8B one_byte_match_emit_encodeBetterBlockAsm8B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeBetterBlockAsm8B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x04 + CMPQ R8, $0x04 JLE emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_4 - CMPQ R9, $0x08 + CMPQ R8, $0x08 JB emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_4through7 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_4: - MOVL (R10), R11 - MOVL R11, (AX) + MOVL (R9), R10 + MOVL R10, (AX) JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_4through7: - MOVL (R10), R11 - MOVL -4(R10)(R9*1), R10 - MOVL R11, (AX) - MOVL R10, -4(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B - -emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B - -emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B - -emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeBetterBlockAsm8B: - MOVQ SI, AX - JMP emit_literal_done_match_emit_encodeBetterBlockAsm8B - -memmove_long_match_emit_encodeBetterBlockAsm8B: - LEAQ (AX)(R9*1), SI - - // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 - JA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 - -emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 - ADDQ $0x20, R14 - DECQ R13 - JNA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_big_loop_back - -emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 - JAE emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX - -emit_literal_done_match_emit_encodeBetterBlockAsm8B: - ADDL R12, CX - ADDL $0x04, R12 - MOVL CX, 12(SP) - - // emitCopy -two_byte_offset_match_nolit_encodeBetterBlockAsm8B: - CMPL R12, $0x40 - JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm8B - CMPL R8, $0x00000800 - JAE long_offset_short_match_nolit_encodeBetterBlockAsm8B - MOVL $0x00000001, SI - LEAL 16(SI), SI - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, SI - MOVB SI, (AX) - ADDQ $0x02, AX - SUBL $0x08, R12 - - // emitRepeat - LEAL -4(R12), R12 - JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 - JLE repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b - CMPL SI, $0x0c - JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b - -cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: - CMPL R12, $0x00000104 - JLT repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b - LEAL -256(R12), R12 - MOVW $0x0019, (AX) - MOVW R12, 2(AX) - ADDQ $0x04, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: - LEAL -4(R12), R12 - MOVW $0x0015, (AX) - MOVB R12, 2(AX) - ADDQ $0x03, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) - ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) - ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -long_offset_short_match_nolit_encodeBetterBlockAsm8B: - MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 - ADDQ $0x03, AX - - // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 - JLE repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short - CMPL SI, $0x0c - JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short - -cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short: - CMPL R12, $0x00000104 - JLT repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short - LEAL -256(R12), R12 - MOVW $0x0019, (AX) - MOVW R12, 2(AX) - ADDQ $0x04, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short: - LEAL -4(R12), R12 - MOVW $0x0015, (AX) - MOVB R12, 2(AX) - ADDQ $0x03, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) - ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) - ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - JMP two_byte_offset_match_nolit_encodeBetterBlockAsm8B - -two_byte_offset_short_match_nolit_encodeBetterBlockAsm8B: - CMPL R12, $0x0c - JGE emit_copy_three_match_nolit_encodeBetterBlockAsm8B - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) - ADDQ $0x02, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -emit_copy_three_match_nolit_encodeBetterBlockAsm8B: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - -match_is_repeat_encodeBetterBlockAsm8B: - MOVL 12(SP), SI - CMPL SI, DI - JEQ emit_literal_done_match_emit_repeat_encodeBetterBlockAsm8B - MOVL DI, R8 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R9 - SUBL SI, R8 - LEAL -1(R8), SI - CMPL SI, $0x3c - JLT one_byte_match_emit_repeat_encodeBetterBlockAsm8B - CMPL SI, $0x00000100 - JLT two_bytes_match_emit_repeat_encodeBetterBlockAsm8B - MOVB $0xf4, (AX) - MOVW SI, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm8B - -two_bytes_match_emit_repeat_encodeBetterBlockAsm8B: - MOVB $0xf0, (AX) - MOVB SI, 1(AX) - ADDQ $0x02, AX - CMPL SI, $0x40 - JL memmove_match_emit_repeat_encodeBetterBlockAsm8B - JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm8B - -one_byte_match_emit_repeat_encodeBetterBlockAsm8B: - SHLB $0x02, SI - MOVB SI, (AX) - ADDQ $0x01, AX - -memmove_match_emit_repeat_encodeBetterBlockAsm8B: - LEAQ (AX)(R8*1), SI - - // genMemMoveShort - CMPQ R8, $0x04 - JLE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4 - CMPQ R8, $0x08 - JB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4through7 - CMPQ R8, $0x10 - JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_8through16 - CMPQ R8, $0x20 - JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_33through64 - -emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4: - MOVL (R9), R10 - MOVL R10, (AX) - JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B - -emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4through7: MOVL (R9), R10 MOVL -4(R9)(R8*1), R9 MOVL R10, (AX) MOVL R9, -4(AX)(R8*1) - JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B -emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_8through16: +emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_8through16: MOVQ (R9), R10 MOVQ -8(R9)(R8*1), R9 MOVQ R10, (AX) MOVQ R9, -8(AX)(R8*1) - JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B -emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_17through32: +emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_17through32: MOVOU (R9), X0 MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) MOVOU X1, -16(AX)(R8*1) - JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + JMP memmove_end_copy_match_emit_encodeBetterBlockAsm8B -emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_33through64: +emit_lit_memmove_match_emit_encodeBetterBlockAsm8B_memmove_move_33through64: MOVOU (R9), X0 MOVOU 16(R9), X1 MOVOU -32(R9)(R8*1), X2 @@ -10002,30 +9728,30 @@ emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_33through MOVOU X2, -32(AX)(R8*1) MOVOU X3, -16(AX)(R8*1) -memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B: - MOVQ SI, AX - JMP emit_literal_done_match_emit_repeat_encodeBetterBlockAsm8B +memmove_end_copy_match_emit_encodeBetterBlockAsm8B: + MOVQ BX, AX + JMP emit_literal_done_match_emit_encodeBetterBlockAsm8B -memmove_long_match_emit_repeat_encodeBetterBlockAsm8B: - LEAQ (AX)(R8*1), SI +memmove_long_match_emit_encodeBetterBlockAsm8B: + LEAQ (AX)(R8*1), BX // genMemMoveLong MOVOU (R9), X0 MOVOU 16(R9), X1 MOVOU -32(R9)(R8*1), X2 MOVOU -16(R9)(R8*1), X3 - MOVQ R8, R11 - SHRQ $0x05, R11 + MOVQ R8, R12 + SHRQ $0x05, R12 MOVQ AX, R10 ANDL $0x0000001f, R10 MOVQ $0x00000040, R13 SUBQ R10, R13 - DECQ R11 - JA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 + DECQ R12 + JA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 LEAQ -32(R9)(R13*1), R10 LEAQ -32(AX)(R13*1), R14 -emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_big_loop_back: +emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_big_loop_back: MOVOU (R10), X4 MOVOU 16(R10), X5 MOVOA X4, (R14) @@ -10033,65 +9759,323 @@ emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_big_loop_bac ADDQ $0x20, R14 ADDQ $0x20, R10 ADDQ $0x20, R13 - DECQ R11 - JNA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_big_loop_back + DECQ R12 + JNA emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_big_loop_back -emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_forward_sse_loop_32: +emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_forward_sse_loop_32: MOVOU -32(R9)(R13*1), X4 MOVOU -16(R9)(R13*1), X5 MOVOA X4, -32(AX)(R13*1) MOVOA X5, -16(AX)(R13*1) ADDQ $0x20, R13 CMPQ R8, R13 - JAE emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 + JAE emit_lit_memmove_long_match_emit_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) MOVOU X2, -32(AX)(R8*1) MOVOU X3, -16(AX)(R8*1) - MOVQ SI, AX + MOVQ BX, AX + +emit_literal_done_match_emit_encodeBetterBlockAsm8B: + ADDL R11, CX + ADDL $0x04, R11 + MOVL CX, 12(SP) + + // emitCopy + CMPL R11, $0x40 + JLE two_byte_offset_short_match_nolit_encodeBetterBlockAsm8B + CMPL DI, $0x00000800 + JAE long_offset_short_match_nolit_encodeBetterBlockAsm8B + MOVL $0x00000001, BX + LEAL 16(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) + ADDQ $0x02, AX + SUBL $0x08, R11 + + // emitRepeat + LEAL -4(R11), R11 + JMP cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + CMPL BX, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: + CMPL R11, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b + LEAL -256(R11), R11 + MOVW $0x0019, (AX) + MOVW R11, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: + LEAL -4(R11), R11 + MOVW $0x0015, (AX) + MOVB R11, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short_2b: + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +long_offset_short_match_nolit_encodeBetterBlockAsm8B: + MOVB $0xee, (AX) + MOVW DI, 1(AX) + LEAL -60(R11), R11 + ADDQ $0x03, AX + + // emitRepeat + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 + JLE repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short + CMPL BX, $0x0c + JGE cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short + +cant_repeat_two_offset_match_nolit_encodeBetterBlockAsm8B_emit_copy_short: + CMPL R11, $0x00000104 + JLT repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short + LEAL -256(R11), R11 + MOVW $0x0019, (AX) + MOVW R11, 2(AX) + ADDQ $0x04, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +repeat_three_match_nolit_encodeBetterBlockAsm8B_emit_copy_short: + LEAL -4(R11), R11 + MOVW $0x0015, (AX) + MOVB R11, 2(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +repeat_two_match_nolit_encodeBetterBlockAsm8B_emit_copy_short: + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +two_byte_offset_short_match_nolit_encodeBetterBlockAsm8B: + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c + JGE emit_copy_three_match_nolit_encodeBetterBlockAsm8B + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +emit_copy_three_match_nolit_encodeBetterBlockAsm8B: + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B + +match_is_repeat_encodeBetterBlockAsm8B: + MOVL 12(SP), BX + CMPL BX, SI + JEQ emit_literal_done_match_emit_repeat_encodeBetterBlockAsm8B + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c + JLT one_byte_match_emit_repeat_encodeBetterBlockAsm8B + CMPL BX, $0x00000100 + JLT two_bytes_match_emit_repeat_encodeBetterBlockAsm8B + MOVB $0xf4, (AX) + MOVW BX, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm8B + +two_bytes_match_emit_repeat_encodeBetterBlockAsm8B: + MOVB $0xf0, (AX) + MOVB BL, 1(AX) + ADDQ $0x02, AX + CMPL BX, $0x40 + JL memmove_match_emit_repeat_encodeBetterBlockAsm8B + JMP memmove_long_match_emit_repeat_encodeBetterBlockAsm8B + +one_byte_match_emit_repeat_encodeBetterBlockAsm8B: + SHLB $0x02, BL + MOVB BL, (AX) + ADDQ $0x01, AX + +memmove_match_emit_repeat_encodeBetterBlockAsm8B: + LEAQ (AX)(DI*1), BX + + // genMemMoveShort + CMPQ DI, $0x04 + JLE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4 + CMPQ DI, $0x08 + JB emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4through7 + CMPQ DI, $0x10 + JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_8through16 + CMPQ DI, $0x20 + JBE emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_33through64 + +emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4: + MOVL (R8), R9 + MOVL R9, (AX) + JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + +emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_4through7: + MOVL (R8), R9 + MOVL -4(R8)(DI*1), R8 + MOVL R9, (AX) + MOVL R8, -4(AX)(DI*1) + JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + +emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_8through16: + MOVQ (R8), R9 + MOVQ -8(R8)(DI*1), R8 + MOVQ R9, (AX) + MOVQ R8, -8(AX)(DI*1) + JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + +emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_17through32: + MOVOU (R8), X0 + MOVOU -16(R8)(DI*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(DI*1) + JMP memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B + +emit_lit_memmove_match_emit_repeat_encodeBetterBlockAsm8B_memmove_move_33through64: + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + +memmove_end_copy_match_emit_repeat_encodeBetterBlockAsm8B: + MOVQ BX, AX + JMP emit_literal_done_match_emit_repeat_encodeBetterBlockAsm8B + +memmove_long_match_emit_repeat_encodeBetterBlockAsm8B: + LEAQ (AX)(DI*1), BX + + // genMemMoveLong + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVQ DI, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R12 + SUBQ R9, R12 + DECQ R10 + JA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 + LEAQ -32(R8)(R12*1), R9 + LEAQ -32(AX)(R12*1), R13 + +emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R13) + MOVOA X5, 16(R13) + ADDQ $0x20, R13 + ADDQ $0x20, R9 + ADDQ $0x20, R12 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_big_loop_back + +emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_forward_sse_loop_32: + MOVOU -32(R8)(R12*1), X4 + MOVOU -16(R8)(R12*1), X5 + MOVOA X4, -32(AX)(R12*1) + MOVOA X5, -16(AX)(R12*1) + ADDQ $0x20, R12 + CMPQ DI, R12 + JAE emit_lit_memmove_long_match_emit_repeat_encodeBetterBlockAsm8Blarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + MOVQ BX, AX emit_literal_done_match_emit_repeat_encodeBetterBlockAsm8B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitRepeat - MOVL R12, SI - LEAL -4(R12), R12 - CMPL SI, $0x08 + MOVL R11, BX + LEAL -4(R11), R11 + CMPL BX, $0x08 JLE repeat_two_match_nolit_repeat_encodeBetterBlockAsm8B - CMPL SI, $0x0c + CMPL BX, $0x0c JGE cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm8B cant_repeat_two_offset_match_nolit_repeat_encodeBetterBlockAsm8B: - CMPL R12, $0x00000104 + CMPL R11, $0x00000104 JLT repeat_three_match_nolit_repeat_encodeBetterBlockAsm8B - LEAL -256(R12), R12 + LEAL -256(R11), R11 MOVW $0x0019, (AX) - MOVW R12, 2(AX) + MOVW R11, 2(AX) ADDQ $0x04, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B repeat_three_match_nolit_repeat_encodeBetterBlockAsm8B: - LEAL -4(R12), R12 + LEAL -4(R11), R11 MOVW $0x0015, (AX) - MOVB R12, 2(AX) + MOVB R11, 2(AX) ADDQ $0x03, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B repeat_two_match_nolit_repeat_encodeBetterBlockAsm8B: - SHLL $0x02, R12 - ORL $0x01, R12 - MOVW R12, (AX) + SHLL $0x02, R11 + ORL $0x01, R11 + MOVW R11, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeBetterBlockAsm8B - XORQ SI, SI - LEAL 1(SI)(R12*4), R12 - MOVB R8, 1(AX) - SARL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + XORQ BX, BX + LEAL 1(BX)(R11*4), R11 + MOVB DI, 1(AX) + SARL $0x08, DI + SHLL $0x05, DI + ORL DI, R11 + MOVB R11, (AX) ADDQ $0x02, AX match_nolit_emitcopy_end_encodeBetterBlockAsm8B: @@ -10103,54 +10087,51 @@ match_nolit_emitcopy_end_encodeBetterBlockAsm8B: RET match_nolit_dst_ok_encodeBetterBlockAsm8B: - MOVQ $0x0000cf1bbcdcbf9b, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x36, R10 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x36, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x38, R11 + MOVQ $0x0000cf1bbcdcbf9b, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x36, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x38, R10 + SHLQ $0x10, R11 + IMULQ BX, R11 + SHRQ $0x36, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x38, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 4120(SP)(R11*4) - MOVL R15, 4120(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x36, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x38, R11 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x36, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 4120(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeBetterBlockAsm8B + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 4120(SP)(R10*4) + MOVL R13, 4120(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeBetterBlockAsm8B: + CMPQ SI, R8 + JAE search_loop_encodeBetterBlockAsm8B + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x10, DI + IMULQ BX, DI + SHRQ $0x36, DI + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x36, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeBetterBlockAsm8B emit_remainder_encodeBetterBlockAsm8B: MOVQ src_len+32(FP), CX @@ -10332,8 +10313,8 @@ zero_loop_encodeSnappyBlockAsm: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -10343,539 +10324,216 @@ zero_loop_encodeSnappyBlockAsm: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBlockAsm: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x06, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x06, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 SHLQ $0x10, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x32, R10 - SHLQ $0x10, R11 - IMULQ R9, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 - JNE no_repeat_found_encodeSnappyBlockAsm - LEAL 1(CX), DI - MOVL 12(SP), SI - MOVL DI, R8 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + MOVL CX, R8 SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_encodeSnappyBlockAsm + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI JZ repeat_extend_back_end_encodeSnappyBlockAsm repeat_extend_back_loop_encodeSnappyBlockAsm: - CMPL DI, SI + CMPL SI, BX JLE repeat_extend_back_end_encodeSnappyBlockAsm - MOVB -1(DX)(R8*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeSnappyBlockAsm - LEAL -1(DI), DI - DECL R8 + LEAL -1(SI), SI + DECL DI JNZ repeat_extend_back_loop_encodeSnappyBlockAsm repeat_extend_back_end_encodeSnappyBlockAsm: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeSnappyBlockAsm - MOVL DI, R8 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R9 - SUBL SI, R8 - LEAL -1(R8), SI - CMPL SI, $0x3c + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeSnappyBlockAsm - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeSnappyBlockAsm - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_repeat_emit_encodeSnappyBlockAsm - CMPL SI, $0x01000000 + CMPL BX, $0x01000000 JLT four_bytes_repeat_emit_encodeSnappyBlockAsm MOVB $0xfc, (AX) - MOVL SI, 1(AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm four_bytes_repeat_emit_encodeSnappyBlockAsm: - MOVL SI, R10 - SHRL $0x10, R10 + MOVL BX, R9 + SHRL $0x10, R9 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R10, 3(AX) + MOVW BX, 1(AX) + MOVB R9, 3(AX) ADDQ $0x04, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm three_bytes_repeat_emit_encodeSnappyBlockAsm: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm two_bytes_repeat_emit_encodeSnappyBlockAsm: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeSnappyBlockAsm JMP memmove_long_repeat_emit_encodeSnappyBlockAsm one_byte_repeat_emit_encodeSnappyBlockAsm: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeSnappyBlockAsm: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveShort - CMPQ R8, $0x08 + CMPQ DI, $0x08 JLE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_8 - CMPQ R8, $0x10 + CMPQ DI, $0x10 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_8through16 - CMPQ R8, $0x20 + CMPQ DI, $0x20 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_8: - MOVQ (R9), R10 - MOVQ R10, (AX) + MOVQ (R8), R9 + MOVQ R9, (AX) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_8through16: - MOVQ (R9), R10 - MOVQ -8(R9)(R8*1), R9 - MOVQ R10, (AX) - MOVQ R9, -8(AX)(R8*1) + MOVQ (R8), R9 + MOVQ -8(R8)(DI*1), R8 + MOVQ R9, (AX) + MOVQ R8, -8(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_17through32: - MOVOU (R9), X0 - MOVOU -16(R9)(R8*1), X1 + MOVOU (R8), X0 + MOVOU -16(R8)(DI*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R8*1) + MOVOU X1, -16(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm_memmove_move_33through64: - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) memmove_end_copy_repeat_emit_encodeSnappyBlockAsm: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeSnappyBlockAsm memmove_long_repeat_emit_encodeSnappyBlockAsm: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveLong - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 - MOVQ R8, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVQ DI, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(R9)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(R8)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsmlarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsmlarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(R9)(R12*1), X4 - MOVOU -16(R9)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R8, R12 + MOVOU -32(R8)(R11*1), X4 + MOVOU -16(R8)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ DI, R11 JAE emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeSnappyBlockAsm: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), SI - - // matchLen - XORL R11, R11 - CMPL R8, $0x08 - JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm - -matchlen_loopback_repeat_extend_encodeSnappyBlockAsm: - MOVQ (R9)(R11*1), R10 - XORQ (SI)(R11*1), R10 - TESTQ R10, R10 - JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm - -#ifdef GOAMD64_v3 - TZCNTQ R10, R10 - -#else - BSFQ R10, R10 - -#endif - SARQ $0x03, R10 - LEAL (R11)(R10*1), R11 - JMP repeat_extend_forward_end_encodeSnappyBlockAsm - -matchlen_loop_repeat_extend_encodeSnappyBlockAsm: - LEAL -8(R8), R8 - LEAL 8(R11), R11 - CMPL R8, $0x08 - JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm - JZ repeat_extend_forward_end_encodeSnappyBlockAsm - -matchlen_match4_repeat_extend_encodeSnappyBlockAsm: - CMPL R8, $0x04 - JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm - MOVL (R9)(R11*1), R10 - CMPL (SI)(R11*1), R10 - JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm - SUBL $0x04, R8 - LEAL 4(R11), R11 - -matchlen_match2_repeat_extend_encodeSnappyBlockAsm: - CMPL R8, $0x02 - JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm - MOVW (R9)(R11*1), R10 - CMPW (SI)(R11*1), R10 - JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm - SUBL $0x02, R8 - LEAL 2(R11), R11 - -matchlen_match1_repeat_extend_encodeSnappyBlockAsm: - CMPL R8, $0x01 - JL repeat_extend_forward_end_encodeSnappyBlockAsm - MOVB (R9)(R11*1), R10 - CMPB (SI)(R11*1), R10 - JNE repeat_extend_forward_end_encodeSnappyBlockAsm - LEAL 1(R11), R11 - -repeat_extend_forward_end_encodeSnappyBlockAsm: - ADDL R11, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - - // emitCopy - CMPL DI, $0x00010000 - JL two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm - -four_bytes_loop_back_repeat_as_copy_encodeSnappyBlockAsm: - CMPL SI, $0x40 - JLE four_bytes_remain_repeat_as_copy_encodeSnappyBlockAsm - MOVB $0xff, (AX) - MOVL DI, 1(AX) - LEAL -64(SI), SI - ADDQ $0x05, AX - CMPL SI, $0x04 - JL four_bytes_remain_repeat_as_copy_encodeSnappyBlockAsm - JMP four_bytes_loop_back_repeat_as_copy_encodeSnappyBlockAsm - -four_bytes_remain_repeat_as_copy_encodeSnappyBlockAsm: - TESTL SI, SI - JZ repeat_end_emit_encodeSnappyBlockAsm - MOVB $0x03, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVL DI, 1(AX) - ADDQ $0x05, AX - JMP repeat_end_emit_encodeSnappyBlockAsm - -two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm: - CMPL SI, $0x40 - JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm - MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI - ADDQ $0x03, AX - JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm - -two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm: - CMPL SI, $0x0c - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm - CMPL DI, $0x00000800 - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeSnappyBlockAsm - -emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) - ADDQ $0x03, AX - -repeat_end_emit_encodeSnappyBlockAsm: - MOVL CX, 12(SP) - JMP search_loop_encodeSnappyBlockAsm - -no_repeat_found_encodeSnappyBlockAsm: - CMPL (DX)(SI*1), DI - JEQ candidate_match_encodeSnappyBlockAsm - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI - JEQ candidate2_match_encodeSnappyBlockAsm - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI - JEQ candidate3_match_encodeSnappyBlockAsm - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBlockAsm - -candidate3_match_encodeSnappyBlockAsm: - ADDL $0x02, CX - JMP candidate_match_encodeSnappyBlockAsm - -candidate2_match_encodeSnappyBlockAsm: - MOVL R9, 24(SP)(R10*4) - INCL CX - MOVL R8, SI - -candidate_match_encodeSnappyBlockAsm: - MOVL 12(SP), DI - TESTL SI, SI - JZ match_extend_back_end_encodeSnappyBlockAsm - -match_extend_back_loop_encodeSnappyBlockAsm: - CMPL CX, DI - JLE match_extend_back_end_encodeSnappyBlockAsm - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 - JNE match_extend_back_end_encodeSnappyBlockAsm - LEAL -1(CX), CX - DECL SI - JZ match_extend_back_end_encodeSnappyBlockAsm - JMP match_extend_back_loop_encodeSnappyBlockAsm - -match_extend_back_end_encodeSnappyBlockAsm: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 5(AX)(DI*1), DI - CMPQ DI, (SP) - JL match_dst_size_check_encodeSnappyBlockAsm - MOVQ $0x00000000, ret+48(FP) - RET - -match_dst_size_check_encodeSnappyBlockAsm: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI - JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c - JLT one_byte_match_emit_encodeSnappyBlockAsm - CMPL R8, $0x00000100 - JLT two_bytes_match_emit_encodeSnappyBlockAsm - CMPL R8, $0x00010000 - JLT three_bytes_match_emit_encodeSnappyBlockAsm - CMPL R8, $0x01000000 - JLT four_bytes_match_emit_encodeSnappyBlockAsm - MOVB $0xfc, (AX) - MOVL R8, 1(AX) - ADDQ $0x05, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm - -four_bytes_match_emit_encodeSnappyBlockAsm: - MOVL R8, R10 - SHRL $0x10, R10 - MOVB $0xf8, (AX) - MOVW R8, 1(AX) - MOVB R10, 3(AX) - ADDQ $0x04, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm - -three_bytes_match_emit_encodeSnappyBlockAsm: - MOVB $0xf4, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm - -two_bytes_match_emit_encodeSnappyBlockAsm: - MOVB $0xf0, (AX) - MOVB R8, 1(AX) - ADDQ $0x02, AX - CMPL R8, $0x40 - JL memmove_match_emit_encodeSnappyBlockAsm - JMP memmove_long_match_emit_encodeSnappyBlockAsm - -one_byte_match_emit_encodeSnappyBlockAsm: - SHLB $0x02, R8 - MOVB R8, (AX) - ADDQ $0x01, AX - -memmove_match_emit_encodeSnappyBlockAsm: - LEAQ (AX)(R9*1), R8 - - // genMemMoveShort - CMPQ R9, $0x08 - JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8 - CMPQ R9, $0x10 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8through16 - CMPQ R9, $0x20 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_33through64 - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeSnappyBlockAsm: - MOVQ R8, AX - JMP emit_literal_done_match_emit_encodeSnappyBlockAsm - -memmove_long_match_emit_encodeSnappyBlockAsm: - LEAQ (AX)(R9*1), R8 - - // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 - JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 - ADDQ $0x20, R12 - DECQ R11 - JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_big_loop_back - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 - JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX - -emit_literal_done_match_emit_encodeSnappyBlockAsm: -match_nolit_loop_encodeSnappyBlockAsm: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) - ADDL $0x04, CX - ADDL $0x04, SI + MOVL CX, BX + SUBL 16(SP), BX MOVQ src_len+32(FP), DI SUBL CX, DI LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + LEAQ (DX)(BX*1), BX // matchLen XORL R10, R10 CMPL DI, $0x08 - JL matchlen_match4_match_nolit_encodeSnappyBlockAsm + JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm -matchlen_loopback_match_nolit_encodeSnappyBlockAsm: +matchlen_loopback_repeat_extend_encodeSnappyBlockAsm: MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 + XORQ (BX)(R10*1), R9 TESTQ R9, R9 - JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm + JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm #ifdef GOAMD64_v3 TZCNTQ R9, R9 @@ -10886,129 +10544,452 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm: #endif SARQ $0x03, R9 LEAL (R10)(R9*1), R10 - JMP match_nolit_end_encodeSnappyBlockAsm + JMP repeat_extend_forward_end_encodeSnappyBlockAsm -matchlen_loop_match_nolit_encodeSnappyBlockAsm: +matchlen_loop_repeat_extend_encodeSnappyBlockAsm: LEAL -8(DI), DI LEAL 8(R10), R10 CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm + JZ repeat_extend_forward_end_encodeSnappyBlockAsm + +matchlen_match4_repeat_extend_encodeSnappyBlockAsm: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_encodeSnappyBlockAsm: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_encodeSnappyBlockAsm: + CMPL DI, $0x01 + JL repeat_extend_forward_end_encodeSnappyBlockAsm + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_encodeSnappyBlockAsm + LEAL 1(R10), R10 + +repeat_extend_forward_end_encodeSnappyBlockAsm: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy + CMPL SI, $0x00010000 + JL two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm + +four_bytes_loop_back_repeat_as_copy_encodeSnappyBlockAsm: + CMPL BX, $0x40 + JLE four_bytes_remain_repeat_as_copy_encodeSnappyBlockAsm + MOVB $0xff, (AX) + MOVL SI, 1(AX) + LEAL -64(BX), BX + ADDQ $0x05, AX + CMPL BX, $0x04 + JL four_bytes_remain_repeat_as_copy_encodeSnappyBlockAsm + JMP four_bytes_loop_back_repeat_as_copy_encodeSnappyBlockAsm + +four_bytes_remain_repeat_as_copy_encodeSnappyBlockAsm: + TESTL BX, BX + JZ repeat_end_emit_encodeSnappyBlockAsm + XORL DI, DI + LEAL -1(DI)(BX*4), BX + MOVB BL, (AX) + MOVL SI, 1(AX) + ADDQ $0x05, AX + JMP repeat_end_emit_encodeSnappyBlockAsm + +two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm + MOVB $0xee, (AX) + MOVW SI, 1(AX) + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm + +two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm + CMPL SI, $0x00000800 + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeSnappyBlockAsm + +emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) + ADDQ $0x03, AX + +repeat_end_emit_encodeSnappyBlockAsm: + MOVL CX, 12(SP) + JMP search_loop_encodeSnappyBlockAsm + +no_repeat_found_encodeSnappyBlockAsm: + CMPL (DX)(BX*1), SI + JEQ candidate_match_encodeSnappyBlockAsm + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_encodeSnappyBlockAsm + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_encodeSnappyBlockAsm + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBlockAsm + +candidate3_match_encodeSnappyBlockAsm: + ADDL $0x02, CX + JMP candidate_match_encodeSnappyBlockAsm + +candidate2_match_encodeSnappyBlockAsm: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_encodeSnappyBlockAsm: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_encodeSnappyBlockAsm + +match_extend_back_loop_encodeSnappyBlockAsm: + CMPL CX, SI + JLE match_extend_back_end_encodeSnappyBlockAsm + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_encodeSnappyBlockAsm + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_encodeSnappyBlockAsm + JMP match_extend_back_loop_encodeSnappyBlockAsm + +match_extend_back_end_encodeSnappyBlockAsm: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 5(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_encodeSnappyBlockAsm + MOVQ $0x00000000, ret+48(FP) + RET + +match_dst_size_check_encodeSnappyBlockAsm: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c + JLT one_byte_match_emit_encodeSnappyBlockAsm + CMPL DI, $0x00000100 + JLT two_bytes_match_emit_encodeSnappyBlockAsm + CMPL DI, $0x00010000 + JLT three_bytes_match_emit_encodeSnappyBlockAsm + CMPL DI, $0x01000000 + JLT four_bytes_match_emit_encodeSnappyBlockAsm + MOVB $0xfc, (AX) + MOVL DI, 1(AX) + ADDQ $0x05, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm + +four_bytes_match_emit_encodeSnappyBlockAsm: + MOVL DI, R9 + SHRL $0x10, R9 + MOVB $0xf8, (AX) + MOVW DI, 1(AX) + MOVB R9, 3(AX) + ADDQ $0x04, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm + +three_bytes_match_emit_encodeSnappyBlockAsm: + MOVB $0xf4, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm + +two_bytes_match_emit_encodeSnappyBlockAsm: + MOVB $0xf0, (AX) + MOVB DI, 1(AX) + ADDQ $0x02, AX + CMPL DI, $0x40 + JL memmove_match_emit_encodeSnappyBlockAsm + JMP memmove_long_match_emit_encodeSnappyBlockAsm + +one_byte_match_emit_encodeSnappyBlockAsm: + SHLB $0x02, DI + MOVB DI, (AX) + ADDQ $0x01, AX + +memmove_match_emit_encodeSnappyBlockAsm: + LEAQ (AX)(R8*1), DI + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_33through64 + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8: + MOVQ (SI), R9 + MOVQ R9, (AX) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_8through16: + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_17through32: + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm_memmove_move_33through64: + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_match_emit_encodeSnappyBlockAsm: + MOVQ DI, AX + JMP emit_literal_done_match_emit_encodeSnappyBlockAsm + +memmove_long_match_emit_encodeSnappyBlockAsm: + LEAQ (AX)(R8*1), DI + + // genMemMoveLong + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 + JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) + ADDQ $0x20, R12 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_big_loop_back + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32: + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 + JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsmlarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX + +emit_literal_done_match_emit_encodeSnappyBlockAsm: +match_nolit_loop_encodeSnappyBlockAsm: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_encodeSnappyBlockAsm + +matchlen_loopback_match_nolit_encodeSnappyBlockAsm: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_encodeSnappyBlockAsm + +matchlen_loop_match_nolit_encodeSnappyBlockAsm: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBlockAsm JZ match_nolit_end_encodeSnappyBlockAsm matchlen_match4_match_nolit_encodeSnappyBlockAsm: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBlockAsm - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBlockAsm - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeSnappyBlockAsm: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeSnappyBlockAsm - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeSnappyBlockAsm: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JL two_byte_offset_match_nolit_encodeSnappyBlockAsm four_bytes_loop_back_match_nolit_encodeSnappyBlockAsm: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE four_bytes_remain_match_nolit_encodeSnappyBlockAsm MOVB $0xff, (AX) - MOVL SI, 1(AX) - LEAL -64(R10), R10 + MOVL BX, 1(AX) + LEAL -64(R9), R9 ADDQ $0x05, AX - CMPL R10, $0x04 + CMPL R9, $0x04 JL four_bytes_remain_match_nolit_encodeSnappyBlockAsm JMP four_bytes_loop_back_match_nolit_encodeSnappyBlockAsm four_bytes_remain_match_nolit_encodeSnappyBlockAsm: - TESTL R10, R10 + TESTL R9, R9 JZ match_nolit_emitcopy_end_encodeSnappyBlockAsm - MOVB $0x03, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVL SI, 1(AX) + XORL SI, SI + LEAL -1(SI)(R9*4), R9 + MOVB R9, (AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeSnappyBlockAsm two_byte_offset_match_nolit_encodeSnappyBlockAsm: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBlockAsm MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBlockAsm two_byte_offset_short_match_nolit_encodeSnappyBlockAsm: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBlockAsm emit_copy_three_match_nolit_encodeSnappyBlockAsm: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBlockAsm: CMPL CX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeSnappyBlockAsm MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeSnappyBlockAsm: - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x10, R8 - IMULQ R9, R8 - SHRQ $0x32, R8 - SHLQ $0x10, SI - IMULQ R9, SI - SHRQ $0x32, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x10, DI + IMULQ R8, DI + SHRQ $0x32, DI + SHLQ $0x10, BX + IMULQ R8, BX + SHRQ $0x32, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeSnappyBlockAsm INCL CX JMP search_loop_encodeSnappyBlockAsm @@ -11212,8 +11193,8 @@ zero_loop_encodeSnappyBlockAsm64K: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -11223,477 +11204,197 @@ zero_loop_encodeSnappyBlockAsm64K: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBlockAsm64K: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x06, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x06, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm64K - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 SHLQ $0x10, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x32, R10 - SHLQ $0x10, R11 - IMULQ R9, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 - JNE no_repeat_found_encodeSnappyBlockAsm64K - LEAL 1(CX), DI - MOVL 12(SP), SI - MOVL DI, R8 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + MOVL CX, R8 SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_encodeSnappyBlockAsm64K + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI JZ repeat_extend_back_end_encodeSnappyBlockAsm64K repeat_extend_back_loop_encodeSnappyBlockAsm64K: - CMPL DI, SI + CMPL SI, BX JLE repeat_extend_back_end_encodeSnappyBlockAsm64K - MOVB -1(DX)(R8*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeSnappyBlockAsm64K - LEAL -1(DI), DI - DECL R8 + LEAL -1(SI), SI + DECL DI JNZ repeat_extend_back_loop_encodeSnappyBlockAsm64K repeat_extend_back_end_encodeSnappyBlockAsm64K: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeSnappyBlockAsm64K - MOVL DI, R8 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R9 - SUBL SI, R8 - LEAL -1(R8), SI - CMPL SI, $0x3c + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeSnappyBlockAsm64K - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeSnappyBlockAsm64K MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm64K two_bytes_repeat_emit_encodeSnappyBlockAsm64K: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeSnappyBlockAsm64K JMP memmove_long_repeat_emit_encodeSnappyBlockAsm64K one_byte_repeat_emit_encodeSnappyBlockAsm64K: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeSnappyBlockAsm64K: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveShort - CMPQ R8, $0x08 + CMPQ DI, $0x08 JLE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_8 - CMPQ R8, $0x10 + CMPQ DI, $0x10 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_8through16 - CMPQ R8, $0x20 + CMPQ DI, $0x20 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_8: - MOVQ (R9), R10 - MOVQ R10, (AX) + MOVQ (R8), R9 + MOVQ R9, (AX) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm64K emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_8through16: - MOVQ (R9), R10 - MOVQ -8(R9)(R8*1), R9 - MOVQ R10, (AX) - MOVQ R9, -8(AX)(R8*1) + MOVQ (R8), R9 + MOVQ -8(R8)(DI*1), R8 + MOVQ R9, (AX) + MOVQ R8, -8(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm64K emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_17through32: - MOVOU (R9), X0 - MOVOU -16(R9)(R8*1), X1 + MOVOU (R8), X0 + MOVOU -16(R8)(DI*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R8*1) + MOVOU X1, -16(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm64K emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm64K_memmove_move_33through64: - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) memmove_end_copy_repeat_emit_encodeSnappyBlockAsm64K: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeSnappyBlockAsm64K memmove_long_repeat_emit_encodeSnappyBlockAsm64K: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveLong - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 - MOVQ R8, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVQ DI, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32 - LEAQ -32(R9)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(R8)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm64Klarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm64Klarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32: - MOVOU -32(R9)(R12*1), X4 - MOVOU -16(R9)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R8, R12 + MOVOU -32(R8)(R11*1), X4 + MOVOU -16(R8)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ DI, R11 JAE emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeSnappyBlockAsm64K: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), SI - - // matchLen - XORL R11, R11 - CMPL R8, $0x08 - JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K - -matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K: - MOVQ (R9)(R11*1), R10 - XORQ (SI)(R11*1), R10 - TESTQ R10, R10 - JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm64K - -#ifdef GOAMD64_v3 - TZCNTQ R10, R10 - -#else - BSFQ R10, R10 - -#endif - SARQ $0x03, R10 - LEAL (R11)(R10*1), R11 - JMP repeat_extend_forward_end_encodeSnappyBlockAsm64K - -matchlen_loop_repeat_extend_encodeSnappyBlockAsm64K: - LEAL -8(R8), R8 - LEAL 8(R11), R11 - CMPL R8, $0x08 - JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K - JZ repeat_extend_forward_end_encodeSnappyBlockAsm64K - -matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K: - CMPL R8, $0x04 - JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K - MOVL (R9)(R11*1), R10 - CMPL (SI)(R11*1), R10 - JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K - SUBL $0x04, R8 - LEAL 4(R11), R11 - -matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K: - CMPL R8, $0x02 - JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K - MOVW (R9)(R11*1), R10 - CMPW (SI)(R11*1), R10 - JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K - SUBL $0x02, R8 - LEAL 2(R11), R11 - -matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K: - CMPL R8, $0x01 - JL repeat_extend_forward_end_encodeSnappyBlockAsm64K - MOVB (R9)(R11*1), R10 - CMPB (SI)(R11*1), R10 - JNE repeat_extend_forward_end_encodeSnappyBlockAsm64K - LEAL 1(R11), R11 - -repeat_extend_forward_end_encodeSnappyBlockAsm64K: - ADDL R11, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - - // emitCopy -two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm64K: - CMPL SI, $0x40 - JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm64K - MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI - ADDQ $0x03, AX - JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm64K - -two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm64K: - CMPL SI, $0x0c - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm64K - CMPL DI, $0x00000800 - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm64K - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeSnappyBlockAsm64K - -emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm64K: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) - ADDQ $0x03, AX - -repeat_end_emit_encodeSnappyBlockAsm64K: - MOVL CX, 12(SP) - JMP search_loop_encodeSnappyBlockAsm64K - -no_repeat_found_encodeSnappyBlockAsm64K: - CMPL (DX)(SI*1), DI - JEQ candidate_match_encodeSnappyBlockAsm64K - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI - JEQ candidate2_match_encodeSnappyBlockAsm64K - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI - JEQ candidate3_match_encodeSnappyBlockAsm64K - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBlockAsm64K - -candidate3_match_encodeSnappyBlockAsm64K: - ADDL $0x02, CX - JMP candidate_match_encodeSnappyBlockAsm64K - -candidate2_match_encodeSnappyBlockAsm64K: - MOVL R9, 24(SP)(R10*4) - INCL CX - MOVL R8, SI - -candidate_match_encodeSnappyBlockAsm64K: - MOVL 12(SP), DI - TESTL SI, SI - JZ match_extend_back_end_encodeSnappyBlockAsm64K - -match_extend_back_loop_encodeSnappyBlockAsm64K: - CMPL CX, DI - JLE match_extend_back_end_encodeSnappyBlockAsm64K - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 - JNE match_extend_back_end_encodeSnappyBlockAsm64K - LEAL -1(CX), CX - DECL SI - JZ match_extend_back_end_encodeSnappyBlockAsm64K - JMP match_extend_back_loop_encodeSnappyBlockAsm64K - -match_extend_back_end_encodeSnappyBlockAsm64K: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) - JL match_dst_size_check_encodeSnappyBlockAsm64K - MOVQ $0x00000000, ret+48(FP) - RET - -match_dst_size_check_encodeSnappyBlockAsm64K: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI - JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm64K - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c - JLT one_byte_match_emit_encodeSnappyBlockAsm64K - CMPL R8, $0x00000100 - JLT two_bytes_match_emit_encodeSnappyBlockAsm64K - MOVB $0xf4, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm64K - -two_bytes_match_emit_encodeSnappyBlockAsm64K: - MOVB $0xf0, (AX) - MOVB R8, 1(AX) - ADDQ $0x02, AX - CMPL R8, $0x40 - JL memmove_match_emit_encodeSnappyBlockAsm64K - JMP memmove_long_match_emit_encodeSnappyBlockAsm64K - -one_byte_match_emit_encodeSnappyBlockAsm64K: - SHLB $0x02, R8 - MOVB R8, (AX) - ADDQ $0x01, AX - -memmove_match_emit_encodeSnappyBlockAsm64K: - LEAQ (AX)(R9*1), R8 - - // genMemMoveShort - CMPQ R9, $0x08 - JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8 - CMPQ R9, $0x10 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8through16 - CMPQ R9, $0x20 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_33through64 - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm64K - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm64K - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm64K - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeSnappyBlockAsm64K: - MOVQ R8, AX - JMP emit_literal_done_match_emit_encodeSnappyBlockAsm64K - -memmove_long_match_emit_encodeSnappyBlockAsm64K: - LEAQ (AX)(R9*1), R8 - - // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 - JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 - ADDQ $0x20, R12 - DECQ R11 - JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_big_loop_back - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 - JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX - -emit_literal_done_match_emit_encodeSnappyBlockAsm64K: -match_nolit_loop_encodeSnappyBlockAsm64K: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) - ADDL $0x04, CX - ADDL $0x04, SI + MOVL CX, BX + SUBL 16(SP), BX MOVQ src_len+32(FP), DI SUBL CX, DI LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + LEAQ (DX)(BX*1), BX // matchLen XORL R10, R10 CMPL DI, $0x08 - JL matchlen_match4_match_nolit_encodeSnappyBlockAsm64K + JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K -matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K: +matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K: MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 + XORQ (BX)(R10*1), R9 TESTQ R9, R9 - JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm64K + JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm64K #ifdef GOAMD64_v3 TZCNTQ R9, R9 @@ -11704,105 +11405,385 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K: #endif SARQ $0x03, R9 LEAL (R10)(R9*1), R10 - JMP match_nolit_end_encodeSnappyBlockAsm64K + JMP repeat_extend_forward_end_encodeSnappyBlockAsm64K -matchlen_loop_match_nolit_encodeSnappyBlockAsm64K: +matchlen_loop_repeat_extend_encodeSnappyBlockAsm64K: LEAL -8(DI), DI LEAL 8(R10), R10 CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K + JZ repeat_extend_forward_end_encodeSnappyBlockAsm64K + +matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K: + CMPL DI, $0x01 + JL repeat_extend_forward_end_encodeSnappyBlockAsm64K + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_encodeSnappyBlockAsm64K + LEAL 1(R10), R10 + +repeat_extend_forward_end_encodeSnappyBlockAsm64K: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy +two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm64K: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm64K + MOVB $0xee, (AX) + MOVW SI, 1(AX) + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm64K + +two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm64K: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm64K + CMPL SI, $0x00000800 + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm64K + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeSnappyBlockAsm64K + +emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm64K: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) + ADDQ $0x03, AX + +repeat_end_emit_encodeSnappyBlockAsm64K: + MOVL CX, 12(SP) + JMP search_loop_encodeSnappyBlockAsm64K + +no_repeat_found_encodeSnappyBlockAsm64K: + CMPL (DX)(BX*1), SI + JEQ candidate_match_encodeSnappyBlockAsm64K + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_encodeSnappyBlockAsm64K + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_encodeSnappyBlockAsm64K + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBlockAsm64K + +candidate3_match_encodeSnappyBlockAsm64K: + ADDL $0x02, CX + JMP candidate_match_encodeSnappyBlockAsm64K + +candidate2_match_encodeSnappyBlockAsm64K: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_encodeSnappyBlockAsm64K: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_encodeSnappyBlockAsm64K + +match_extend_back_loop_encodeSnappyBlockAsm64K: + CMPL CX, SI + JLE match_extend_back_end_encodeSnappyBlockAsm64K + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_encodeSnappyBlockAsm64K + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_encodeSnappyBlockAsm64K + JMP match_extend_back_loop_encodeSnappyBlockAsm64K + +match_extend_back_end_encodeSnappyBlockAsm64K: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_encodeSnappyBlockAsm64K + MOVQ $0x00000000, ret+48(FP) + RET + +match_dst_size_check_encodeSnappyBlockAsm64K: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm64K + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c + JLT one_byte_match_emit_encodeSnappyBlockAsm64K + CMPL DI, $0x00000100 + JLT two_bytes_match_emit_encodeSnappyBlockAsm64K + MOVB $0xf4, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm64K + +two_bytes_match_emit_encodeSnappyBlockAsm64K: + MOVB $0xf0, (AX) + MOVB DI, 1(AX) + ADDQ $0x02, AX + CMPL DI, $0x40 + JL memmove_match_emit_encodeSnappyBlockAsm64K + JMP memmove_long_match_emit_encodeSnappyBlockAsm64K + +one_byte_match_emit_encodeSnappyBlockAsm64K: + SHLB $0x02, DI + MOVB DI, (AX) + ADDQ $0x01, AX + +memmove_match_emit_encodeSnappyBlockAsm64K: + LEAQ (AX)(R8*1), DI + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_33through64 + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8: + MOVQ (SI), R9 + MOVQ R9, (AX) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm64K + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_8through16: + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm64K + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_17through32: + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm64K + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm64K_memmove_move_33through64: + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_match_emit_encodeSnappyBlockAsm64K: + MOVQ DI, AX + JMP emit_literal_done_match_emit_encodeSnappyBlockAsm64K + +memmove_long_match_emit_encodeSnappyBlockAsm64K: + LEAQ (AX)(R8*1), DI + + // genMemMoveLong + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 + JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) + ADDQ $0x20, R12 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_big_loop_back + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32: + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 + JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm64Klarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX + +emit_literal_done_match_emit_encodeSnappyBlockAsm64K: +match_nolit_loop_encodeSnappyBlockAsm64K: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_encodeSnappyBlockAsm64K + +matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm64K + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_encodeSnappyBlockAsm64K + +matchlen_loop_match_nolit_encodeSnappyBlockAsm64K: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K JZ match_nolit_end_encodeSnappyBlockAsm64K matchlen_match4_match_nolit_encodeSnappyBlockAsm64K: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBlockAsm64K - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm64K - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm64K: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBlockAsm64K - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm64K - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeSnappyBlockAsm64K: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeSnappyBlockAsm64K - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm64K - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeSnappyBlockAsm64K: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBlockAsm64K: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBlockAsm64K MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBlockAsm64K two_byte_offset_short_match_nolit_encodeSnappyBlockAsm64K: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm64K - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm64K - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBlockAsm64K emit_copy_three_match_nolit_encodeSnappyBlockAsm64K: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBlockAsm64K: CMPL CX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm64K - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeSnappyBlockAsm64K MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeSnappyBlockAsm64K: - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x10, R8 - IMULQ R9, R8 - SHRQ $0x32, R8 - SHLQ $0x10, SI - IMULQ R9, SI - SHRQ $0x32, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x10, DI + IMULQ R8, DI + SHRQ $0x32, DI + SHLQ $0x10, BX + IMULQ R8, BX + SHRQ $0x32, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeSnappyBlockAsm64K INCL CX JMP search_loop_encodeSnappyBlockAsm64K @@ -11987,8 +11968,8 @@ zero_loop_encodeSnappyBlockAsm12B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -11998,477 +11979,197 @@ zero_loop_encodeSnappyBlockAsm12B: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBlockAsm12B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x05, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm12B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x000000cf1bbcdcbb, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x000000cf1bbcdcbb, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x18, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 SHLQ $0x18, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x34, R10 - SHLQ $0x18, R11 - IMULQ R9, R11 - SHRQ $0x34, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x18, R10 - IMULQ R9, R10 - SHRQ $0x34, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 - JNE no_repeat_found_encodeSnappyBlockAsm12B - LEAL 1(CX), DI - MOVL 12(SP), SI - MOVL DI, R8 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x18, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 + MOVL CX, R8 SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_encodeSnappyBlockAsm12B + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI JZ repeat_extend_back_end_encodeSnappyBlockAsm12B repeat_extend_back_loop_encodeSnappyBlockAsm12B: - CMPL DI, SI + CMPL SI, BX JLE repeat_extend_back_end_encodeSnappyBlockAsm12B - MOVB -1(DX)(R8*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeSnappyBlockAsm12B - LEAL -1(DI), DI - DECL R8 + LEAL -1(SI), SI + DECL DI JNZ repeat_extend_back_loop_encodeSnappyBlockAsm12B repeat_extend_back_end_encodeSnappyBlockAsm12B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeSnappyBlockAsm12B - MOVL DI, R8 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R9 - SUBL SI, R8 - LEAL -1(R8), SI - CMPL SI, $0x3c + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeSnappyBlockAsm12B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeSnappyBlockAsm12B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm12B two_bytes_repeat_emit_encodeSnappyBlockAsm12B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeSnappyBlockAsm12B JMP memmove_long_repeat_emit_encodeSnappyBlockAsm12B one_byte_repeat_emit_encodeSnappyBlockAsm12B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeSnappyBlockAsm12B: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveShort - CMPQ R8, $0x08 + CMPQ DI, $0x08 JLE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_8 - CMPQ R8, $0x10 + CMPQ DI, $0x10 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_8through16 - CMPQ R8, $0x20 + CMPQ DI, $0x20 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_8: - MOVQ (R9), R10 - MOVQ R10, (AX) + MOVQ (R8), R9 + MOVQ R9, (AX) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm12B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_8through16: - MOVQ (R9), R10 - MOVQ -8(R9)(R8*1), R9 - MOVQ R10, (AX) - MOVQ R9, -8(AX)(R8*1) + MOVQ (R8), R9 + MOVQ -8(R8)(DI*1), R8 + MOVQ R9, (AX) + MOVQ R8, -8(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm12B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_17through32: - MOVOU (R9), X0 - MOVOU -16(R9)(R8*1), X1 + MOVOU (R8), X0 + MOVOU -16(R8)(DI*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R8*1) + MOVOU X1, -16(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm12B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm12B_memmove_move_33through64: - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) memmove_end_copy_repeat_emit_encodeSnappyBlockAsm12B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeSnappyBlockAsm12B memmove_long_repeat_emit_encodeSnappyBlockAsm12B: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveLong - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 - MOVQ R8, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVQ DI, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(R9)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(R8)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm12Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm12Blarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(R9)(R12*1), X4 - MOVOU -16(R9)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R8, R12 + MOVOU -32(R8)(R11*1), X4 + MOVOU -16(R8)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ DI, R11 JAE emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeSnappyBlockAsm12B: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), SI - - // matchLen - XORL R11, R11 - CMPL R8, $0x08 - JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B - -matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B: - MOVQ (R9)(R11*1), R10 - XORQ (SI)(R11*1), R10 - TESTQ R10, R10 - JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm12B - -#ifdef GOAMD64_v3 - TZCNTQ R10, R10 - -#else - BSFQ R10, R10 - -#endif - SARQ $0x03, R10 - LEAL (R11)(R10*1), R11 - JMP repeat_extend_forward_end_encodeSnappyBlockAsm12B - -matchlen_loop_repeat_extend_encodeSnappyBlockAsm12B: - LEAL -8(R8), R8 - LEAL 8(R11), R11 - CMPL R8, $0x08 - JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B - JZ repeat_extend_forward_end_encodeSnappyBlockAsm12B - -matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B: - CMPL R8, $0x04 - JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B - MOVL (R9)(R11*1), R10 - CMPL (SI)(R11*1), R10 - JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B - SUBL $0x04, R8 - LEAL 4(R11), R11 - -matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B: - CMPL R8, $0x02 - JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B - MOVW (R9)(R11*1), R10 - CMPW (SI)(R11*1), R10 - JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B - SUBL $0x02, R8 - LEAL 2(R11), R11 - -matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B: - CMPL R8, $0x01 - JL repeat_extend_forward_end_encodeSnappyBlockAsm12B - MOVB (R9)(R11*1), R10 - CMPB (SI)(R11*1), R10 - JNE repeat_extend_forward_end_encodeSnappyBlockAsm12B - LEAL 1(R11), R11 - -repeat_extend_forward_end_encodeSnappyBlockAsm12B: - ADDL R11, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - - // emitCopy -two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm12B: - CMPL SI, $0x40 - JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm12B - MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI - ADDQ $0x03, AX - JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm12B - -two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm12B: - CMPL SI, $0x0c - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm12B - CMPL DI, $0x00000800 - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm12B - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeSnappyBlockAsm12B - -emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm12B: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) - ADDQ $0x03, AX - -repeat_end_emit_encodeSnappyBlockAsm12B: - MOVL CX, 12(SP) - JMP search_loop_encodeSnappyBlockAsm12B - -no_repeat_found_encodeSnappyBlockAsm12B: - CMPL (DX)(SI*1), DI - JEQ candidate_match_encodeSnappyBlockAsm12B - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI - JEQ candidate2_match_encodeSnappyBlockAsm12B - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI - JEQ candidate3_match_encodeSnappyBlockAsm12B - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBlockAsm12B - -candidate3_match_encodeSnappyBlockAsm12B: - ADDL $0x02, CX - JMP candidate_match_encodeSnappyBlockAsm12B - -candidate2_match_encodeSnappyBlockAsm12B: - MOVL R9, 24(SP)(R10*4) - INCL CX - MOVL R8, SI - -candidate_match_encodeSnappyBlockAsm12B: - MOVL 12(SP), DI - TESTL SI, SI - JZ match_extend_back_end_encodeSnappyBlockAsm12B - -match_extend_back_loop_encodeSnappyBlockAsm12B: - CMPL CX, DI - JLE match_extend_back_end_encodeSnappyBlockAsm12B - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 - JNE match_extend_back_end_encodeSnappyBlockAsm12B - LEAL -1(CX), CX - DECL SI - JZ match_extend_back_end_encodeSnappyBlockAsm12B - JMP match_extend_back_loop_encodeSnappyBlockAsm12B - -match_extend_back_end_encodeSnappyBlockAsm12B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) - JL match_dst_size_check_encodeSnappyBlockAsm12B - MOVQ $0x00000000, ret+48(FP) - RET - -match_dst_size_check_encodeSnappyBlockAsm12B: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI - JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm12B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c - JLT one_byte_match_emit_encodeSnappyBlockAsm12B - CMPL R8, $0x00000100 - JLT two_bytes_match_emit_encodeSnappyBlockAsm12B - MOVB $0xf4, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm12B - -two_bytes_match_emit_encodeSnappyBlockAsm12B: - MOVB $0xf0, (AX) - MOVB R8, 1(AX) - ADDQ $0x02, AX - CMPL R8, $0x40 - JL memmove_match_emit_encodeSnappyBlockAsm12B - JMP memmove_long_match_emit_encodeSnappyBlockAsm12B - -one_byte_match_emit_encodeSnappyBlockAsm12B: - SHLB $0x02, R8 - MOVB R8, (AX) - ADDQ $0x01, AX - -memmove_match_emit_encodeSnappyBlockAsm12B: - LEAQ (AX)(R9*1), R8 - - // genMemMoveShort - CMPQ R9, $0x08 - JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8 - CMPQ R9, $0x10 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8through16 - CMPQ R9, $0x20 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_33through64 - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm12B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm12B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm12B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeSnappyBlockAsm12B: - MOVQ R8, AX - JMP emit_literal_done_match_emit_encodeSnappyBlockAsm12B - -memmove_long_match_emit_encodeSnappyBlockAsm12B: - LEAQ (AX)(R9*1), R8 - - // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 - JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 - ADDQ $0x20, R12 - DECQ R11 - JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_big_loop_back - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 - JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX - -emit_literal_done_match_emit_encodeSnappyBlockAsm12B: -match_nolit_loop_encodeSnappyBlockAsm12B: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) - ADDL $0x04, CX - ADDL $0x04, SI + MOVL CX, BX + SUBL 16(SP), BX MOVQ src_len+32(FP), DI SUBL CX, DI LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + LEAQ (DX)(BX*1), BX // matchLen XORL R10, R10 CMPL DI, $0x08 - JL matchlen_match4_match_nolit_encodeSnappyBlockAsm12B + JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B -matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B: +matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B: MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 + XORQ (BX)(R10*1), R9 TESTQ R9, R9 - JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm12B + JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm12B #ifdef GOAMD64_v3 TZCNTQ R9, R9 @@ -12479,105 +12180,385 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B: #endif SARQ $0x03, R9 LEAL (R10)(R9*1), R10 - JMP match_nolit_end_encodeSnappyBlockAsm12B + JMP repeat_extend_forward_end_encodeSnappyBlockAsm12B -matchlen_loop_match_nolit_encodeSnappyBlockAsm12B: +matchlen_loop_repeat_extend_encodeSnappyBlockAsm12B: LEAL -8(DI), DI LEAL 8(R10), R10 CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B + JZ repeat_extend_forward_end_encodeSnappyBlockAsm12B + +matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B: + CMPL DI, $0x01 + JL repeat_extend_forward_end_encodeSnappyBlockAsm12B + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_encodeSnappyBlockAsm12B + LEAL 1(R10), R10 + +repeat_extend_forward_end_encodeSnappyBlockAsm12B: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy +two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm12B: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm12B + MOVB $0xee, (AX) + MOVW SI, 1(AX) + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm12B + +two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm12B: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm12B + CMPL SI, $0x00000800 + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm12B + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeSnappyBlockAsm12B + +emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm12B: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) + ADDQ $0x03, AX + +repeat_end_emit_encodeSnappyBlockAsm12B: + MOVL CX, 12(SP) + JMP search_loop_encodeSnappyBlockAsm12B + +no_repeat_found_encodeSnappyBlockAsm12B: + CMPL (DX)(BX*1), SI + JEQ candidate_match_encodeSnappyBlockAsm12B + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_encodeSnappyBlockAsm12B + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_encodeSnappyBlockAsm12B + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBlockAsm12B + +candidate3_match_encodeSnappyBlockAsm12B: + ADDL $0x02, CX + JMP candidate_match_encodeSnappyBlockAsm12B + +candidate2_match_encodeSnappyBlockAsm12B: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_encodeSnappyBlockAsm12B: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_encodeSnappyBlockAsm12B + +match_extend_back_loop_encodeSnappyBlockAsm12B: + CMPL CX, SI + JLE match_extend_back_end_encodeSnappyBlockAsm12B + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_encodeSnappyBlockAsm12B + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_encodeSnappyBlockAsm12B + JMP match_extend_back_loop_encodeSnappyBlockAsm12B + +match_extend_back_end_encodeSnappyBlockAsm12B: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_encodeSnappyBlockAsm12B + MOVQ $0x00000000, ret+48(FP) + RET + +match_dst_size_check_encodeSnappyBlockAsm12B: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm12B + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c + JLT one_byte_match_emit_encodeSnappyBlockAsm12B + CMPL DI, $0x00000100 + JLT two_bytes_match_emit_encodeSnappyBlockAsm12B + MOVB $0xf4, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm12B + +two_bytes_match_emit_encodeSnappyBlockAsm12B: + MOVB $0xf0, (AX) + MOVB DI, 1(AX) + ADDQ $0x02, AX + CMPL DI, $0x40 + JL memmove_match_emit_encodeSnappyBlockAsm12B + JMP memmove_long_match_emit_encodeSnappyBlockAsm12B + +one_byte_match_emit_encodeSnappyBlockAsm12B: + SHLB $0x02, DI + MOVB DI, (AX) + ADDQ $0x01, AX + +memmove_match_emit_encodeSnappyBlockAsm12B: + LEAQ (AX)(R8*1), DI + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_33through64 + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8: + MOVQ (SI), R9 + MOVQ R9, (AX) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm12B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_8through16: + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm12B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_17through32: + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm12B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm12B_memmove_move_33through64: + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_match_emit_encodeSnappyBlockAsm12B: + MOVQ DI, AX + JMP emit_literal_done_match_emit_encodeSnappyBlockAsm12B + +memmove_long_match_emit_encodeSnappyBlockAsm12B: + LEAQ (AX)(R8*1), DI + + // genMemMoveLong + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 + JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) + ADDQ $0x20, R12 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_big_loop_back + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32: + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 + JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm12Blarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX + +emit_literal_done_match_emit_encodeSnappyBlockAsm12B: +match_nolit_loop_encodeSnappyBlockAsm12B: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_encodeSnappyBlockAsm12B + +matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm12B + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_encodeSnappyBlockAsm12B + +matchlen_loop_match_nolit_encodeSnappyBlockAsm12B: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B JZ match_nolit_end_encodeSnappyBlockAsm12B matchlen_match4_match_nolit_encodeSnappyBlockAsm12B: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBlockAsm12B - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm12B - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm12B: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBlockAsm12B - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm12B - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeSnappyBlockAsm12B: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeSnappyBlockAsm12B - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm12B - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeSnappyBlockAsm12B: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBlockAsm12B: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBlockAsm12B MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBlockAsm12B two_byte_offset_short_match_nolit_encodeSnappyBlockAsm12B: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm12B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm12B - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBlockAsm12B emit_copy_three_match_nolit_encodeSnappyBlockAsm12B: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBlockAsm12B: CMPL CX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm12B - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeSnappyBlockAsm12B MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeSnappyBlockAsm12B: - MOVQ $0x000000cf1bbcdcbb, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x18, R8 - IMULQ R9, R8 - SHRQ $0x34, R8 - SHLQ $0x18, SI - IMULQ R9, SI - SHRQ $0x34, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x000000cf1bbcdcbb, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x18, DI + IMULQ R8, DI + SHRQ $0x34, DI + SHLQ $0x18, BX + IMULQ R8, BX + SHRQ $0x34, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeSnappyBlockAsm12B INCL CX JMP search_loop_encodeSnappyBlockAsm12B @@ -12762,8 +12743,8 @@ zero_loop_encodeSnappyBlockAsm10B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -12773,477 +12754,197 @@ zero_loop_encodeSnappyBlockAsm10B: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBlockAsm10B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x05, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm10B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x9e3779b1, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x9e3779b1, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 SHLQ $0x20, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x36, R10 - SHLQ $0x20, R11 - IMULQ R9, R11 - SHRQ $0x36, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x20, R10 - IMULQ R9, R10 - SHRQ $0x36, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 - JNE no_repeat_found_encodeSnappyBlockAsm10B - LEAL 1(CX), DI - MOVL 12(SP), SI - MOVL DI, R8 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 + MOVL CX, R8 SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_encodeSnappyBlockAsm10B + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI JZ repeat_extend_back_end_encodeSnappyBlockAsm10B repeat_extend_back_loop_encodeSnappyBlockAsm10B: - CMPL DI, SI + CMPL SI, BX JLE repeat_extend_back_end_encodeSnappyBlockAsm10B - MOVB -1(DX)(R8*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeSnappyBlockAsm10B - LEAL -1(DI), DI - DECL R8 + LEAL -1(SI), SI + DECL DI JNZ repeat_extend_back_loop_encodeSnappyBlockAsm10B repeat_extend_back_end_encodeSnappyBlockAsm10B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeSnappyBlockAsm10B - MOVL DI, R8 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R9 - SUBL SI, R8 - LEAL -1(R8), SI - CMPL SI, $0x3c + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeSnappyBlockAsm10B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeSnappyBlockAsm10B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm10B two_bytes_repeat_emit_encodeSnappyBlockAsm10B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeSnappyBlockAsm10B JMP memmove_long_repeat_emit_encodeSnappyBlockAsm10B one_byte_repeat_emit_encodeSnappyBlockAsm10B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeSnappyBlockAsm10B: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveShort - CMPQ R8, $0x08 + CMPQ DI, $0x08 JLE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_8 - CMPQ R8, $0x10 + CMPQ DI, $0x10 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_8through16 - CMPQ R8, $0x20 + CMPQ DI, $0x20 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_8: - MOVQ (R9), R10 - MOVQ R10, (AX) + MOVQ (R8), R9 + MOVQ R9, (AX) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm10B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_8through16: - MOVQ (R9), R10 - MOVQ -8(R9)(R8*1), R9 - MOVQ R10, (AX) - MOVQ R9, -8(AX)(R8*1) + MOVQ (R8), R9 + MOVQ -8(R8)(DI*1), R8 + MOVQ R9, (AX) + MOVQ R8, -8(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm10B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_17through32: - MOVOU (R9), X0 - MOVOU -16(R9)(R8*1), X1 + MOVOU (R8), X0 + MOVOU -16(R8)(DI*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R8*1) + MOVOU X1, -16(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm10B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm10B_memmove_move_33through64: - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) memmove_end_copy_repeat_emit_encodeSnappyBlockAsm10B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeSnappyBlockAsm10B memmove_long_repeat_emit_encodeSnappyBlockAsm10B: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveLong - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 - MOVQ R8, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVQ DI, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(R9)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(R8)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm10Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm10Blarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(R9)(R12*1), X4 - MOVOU -16(R9)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R8, R12 + MOVOU -32(R8)(R11*1), X4 + MOVOU -16(R8)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ DI, R11 JAE emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeSnappyBlockAsm10B: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), SI - - // matchLen - XORL R11, R11 - CMPL R8, $0x08 - JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B - -matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B: - MOVQ (R9)(R11*1), R10 - XORQ (SI)(R11*1), R10 - TESTQ R10, R10 - JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm10B - -#ifdef GOAMD64_v3 - TZCNTQ R10, R10 - -#else - BSFQ R10, R10 - -#endif - SARQ $0x03, R10 - LEAL (R11)(R10*1), R11 - JMP repeat_extend_forward_end_encodeSnappyBlockAsm10B - -matchlen_loop_repeat_extend_encodeSnappyBlockAsm10B: - LEAL -8(R8), R8 - LEAL 8(R11), R11 - CMPL R8, $0x08 - JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B - JZ repeat_extend_forward_end_encodeSnappyBlockAsm10B - -matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B: - CMPL R8, $0x04 - JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B - MOVL (R9)(R11*1), R10 - CMPL (SI)(R11*1), R10 - JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B - SUBL $0x04, R8 - LEAL 4(R11), R11 - -matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B: - CMPL R8, $0x02 - JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B - MOVW (R9)(R11*1), R10 - CMPW (SI)(R11*1), R10 - JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B - SUBL $0x02, R8 - LEAL 2(R11), R11 - -matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B: - CMPL R8, $0x01 - JL repeat_extend_forward_end_encodeSnappyBlockAsm10B - MOVB (R9)(R11*1), R10 - CMPB (SI)(R11*1), R10 - JNE repeat_extend_forward_end_encodeSnappyBlockAsm10B - LEAL 1(R11), R11 - -repeat_extend_forward_end_encodeSnappyBlockAsm10B: - ADDL R11, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - - // emitCopy -two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm10B: - CMPL SI, $0x40 - JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm10B - MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI - ADDQ $0x03, AX - JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm10B - -two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm10B: - CMPL SI, $0x0c - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm10B - CMPL DI, $0x00000800 - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm10B - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeSnappyBlockAsm10B - -emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm10B: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) - ADDQ $0x03, AX - -repeat_end_emit_encodeSnappyBlockAsm10B: - MOVL CX, 12(SP) - JMP search_loop_encodeSnappyBlockAsm10B - -no_repeat_found_encodeSnappyBlockAsm10B: - CMPL (DX)(SI*1), DI - JEQ candidate_match_encodeSnappyBlockAsm10B - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI - JEQ candidate2_match_encodeSnappyBlockAsm10B - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI - JEQ candidate3_match_encodeSnappyBlockAsm10B - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBlockAsm10B - -candidate3_match_encodeSnappyBlockAsm10B: - ADDL $0x02, CX - JMP candidate_match_encodeSnappyBlockAsm10B - -candidate2_match_encodeSnappyBlockAsm10B: - MOVL R9, 24(SP)(R10*4) - INCL CX - MOVL R8, SI - -candidate_match_encodeSnappyBlockAsm10B: - MOVL 12(SP), DI - TESTL SI, SI - JZ match_extend_back_end_encodeSnappyBlockAsm10B - -match_extend_back_loop_encodeSnappyBlockAsm10B: - CMPL CX, DI - JLE match_extend_back_end_encodeSnappyBlockAsm10B - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 - JNE match_extend_back_end_encodeSnappyBlockAsm10B - LEAL -1(CX), CX - DECL SI - JZ match_extend_back_end_encodeSnappyBlockAsm10B - JMP match_extend_back_loop_encodeSnappyBlockAsm10B - -match_extend_back_end_encodeSnappyBlockAsm10B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) - JL match_dst_size_check_encodeSnappyBlockAsm10B - MOVQ $0x00000000, ret+48(FP) - RET - -match_dst_size_check_encodeSnappyBlockAsm10B: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI - JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm10B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c - JLT one_byte_match_emit_encodeSnappyBlockAsm10B - CMPL R8, $0x00000100 - JLT two_bytes_match_emit_encodeSnappyBlockAsm10B - MOVB $0xf4, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm10B - -two_bytes_match_emit_encodeSnappyBlockAsm10B: - MOVB $0xf0, (AX) - MOVB R8, 1(AX) - ADDQ $0x02, AX - CMPL R8, $0x40 - JL memmove_match_emit_encodeSnappyBlockAsm10B - JMP memmove_long_match_emit_encodeSnappyBlockAsm10B - -one_byte_match_emit_encodeSnappyBlockAsm10B: - SHLB $0x02, R8 - MOVB R8, (AX) - ADDQ $0x01, AX - -memmove_match_emit_encodeSnappyBlockAsm10B: - LEAQ (AX)(R9*1), R8 - - // genMemMoveShort - CMPQ R9, $0x08 - JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8 - CMPQ R9, $0x10 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8through16 - CMPQ R9, $0x20 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_33through64 - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm10B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm10B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm10B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeSnappyBlockAsm10B: - MOVQ R8, AX - JMP emit_literal_done_match_emit_encodeSnappyBlockAsm10B - -memmove_long_match_emit_encodeSnappyBlockAsm10B: - LEAQ (AX)(R9*1), R8 - - // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 - JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 - ADDQ $0x20, R12 - DECQ R11 - JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_big_loop_back - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 - JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX - -emit_literal_done_match_emit_encodeSnappyBlockAsm10B: -match_nolit_loop_encodeSnappyBlockAsm10B: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) - ADDL $0x04, CX - ADDL $0x04, SI + MOVL CX, BX + SUBL 16(SP), BX MOVQ src_len+32(FP), DI SUBL CX, DI LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + LEAQ (DX)(BX*1), BX // matchLen XORL R10, R10 CMPL DI, $0x08 - JL matchlen_match4_match_nolit_encodeSnappyBlockAsm10B + JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B -matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B: +matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B: MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 + XORQ (BX)(R10*1), R9 TESTQ R9, R9 - JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm10B + JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm10B #ifdef GOAMD64_v3 TZCNTQ R9, R9 @@ -13254,105 +12955,385 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B: #endif SARQ $0x03, R9 LEAL (R10)(R9*1), R10 - JMP match_nolit_end_encodeSnappyBlockAsm10B + JMP repeat_extend_forward_end_encodeSnappyBlockAsm10B -matchlen_loop_match_nolit_encodeSnappyBlockAsm10B: +matchlen_loop_repeat_extend_encodeSnappyBlockAsm10B: LEAL -8(DI), DI LEAL 8(R10), R10 CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B + JZ repeat_extend_forward_end_encodeSnappyBlockAsm10B + +matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B: + CMPL DI, $0x01 + JL repeat_extend_forward_end_encodeSnappyBlockAsm10B + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_encodeSnappyBlockAsm10B + LEAL 1(R10), R10 + +repeat_extend_forward_end_encodeSnappyBlockAsm10B: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy +two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm10B: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm10B + MOVB $0xee, (AX) + MOVW SI, 1(AX) + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm10B + +two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm10B: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm10B + CMPL SI, $0x00000800 + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm10B + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeSnappyBlockAsm10B + +emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm10B: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) + ADDQ $0x03, AX + +repeat_end_emit_encodeSnappyBlockAsm10B: + MOVL CX, 12(SP) + JMP search_loop_encodeSnappyBlockAsm10B + +no_repeat_found_encodeSnappyBlockAsm10B: + CMPL (DX)(BX*1), SI + JEQ candidate_match_encodeSnappyBlockAsm10B + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_encodeSnappyBlockAsm10B + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_encodeSnappyBlockAsm10B + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBlockAsm10B + +candidate3_match_encodeSnappyBlockAsm10B: + ADDL $0x02, CX + JMP candidate_match_encodeSnappyBlockAsm10B + +candidate2_match_encodeSnappyBlockAsm10B: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_encodeSnappyBlockAsm10B: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_encodeSnappyBlockAsm10B + +match_extend_back_loop_encodeSnappyBlockAsm10B: + CMPL CX, SI + JLE match_extend_back_end_encodeSnappyBlockAsm10B + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_encodeSnappyBlockAsm10B + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_encodeSnappyBlockAsm10B + JMP match_extend_back_loop_encodeSnappyBlockAsm10B + +match_extend_back_end_encodeSnappyBlockAsm10B: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_encodeSnappyBlockAsm10B + MOVQ $0x00000000, ret+48(FP) + RET + +match_dst_size_check_encodeSnappyBlockAsm10B: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm10B + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c + JLT one_byte_match_emit_encodeSnappyBlockAsm10B + CMPL DI, $0x00000100 + JLT two_bytes_match_emit_encodeSnappyBlockAsm10B + MOVB $0xf4, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm10B + +two_bytes_match_emit_encodeSnappyBlockAsm10B: + MOVB $0xf0, (AX) + MOVB DI, 1(AX) + ADDQ $0x02, AX + CMPL DI, $0x40 + JL memmove_match_emit_encodeSnappyBlockAsm10B + JMP memmove_long_match_emit_encodeSnappyBlockAsm10B + +one_byte_match_emit_encodeSnappyBlockAsm10B: + SHLB $0x02, DI + MOVB DI, (AX) + ADDQ $0x01, AX + +memmove_match_emit_encodeSnappyBlockAsm10B: + LEAQ (AX)(R8*1), DI + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_33through64 + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8: + MOVQ (SI), R9 + MOVQ R9, (AX) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm10B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_8through16: + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm10B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_17through32: + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm10B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm10B_memmove_move_33through64: + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_match_emit_encodeSnappyBlockAsm10B: + MOVQ DI, AX + JMP emit_literal_done_match_emit_encodeSnappyBlockAsm10B + +memmove_long_match_emit_encodeSnappyBlockAsm10B: + LEAQ (AX)(R8*1), DI + + // genMemMoveLong + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 + JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) + ADDQ $0x20, R12 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_big_loop_back + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32: + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 + JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm10Blarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX + +emit_literal_done_match_emit_encodeSnappyBlockAsm10B: +match_nolit_loop_encodeSnappyBlockAsm10B: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_encodeSnappyBlockAsm10B + +matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm10B + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_encodeSnappyBlockAsm10B + +matchlen_loop_match_nolit_encodeSnappyBlockAsm10B: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B JZ match_nolit_end_encodeSnappyBlockAsm10B matchlen_match4_match_nolit_encodeSnappyBlockAsm10B: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBlockAsm10B - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm10B - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm10B: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBlockAsm10B - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm10B - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeSnappyBlockAsm10B: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeSnappyBlockAsm10B - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm10B - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeSnappyBlockAsm10B: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBlockAsm10B: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBlockAsm10B MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBlockAsm10B two_byte_offset_short_match_nolit_encodeSnappyBlockAsm10B: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm10B - CMPL SI, $0x00000800 + CMPL BX, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm10B - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBlockAsm10B emit_copy_three_match_nolit_encodeSnappyBlockAsm10B: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBlockAsm10B: CMPL CX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm10B - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeSnappyBlockAsm10B MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeSnappyBlockAsm10B: - MOVQ $0x9e3779b1, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x20, R8 - IMULQ R9, R8 - SHRQ $0x36, R8 - SHLQ $0x20, SI - IMULQ R9, SI - SHRQ $0x36, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x9e3779b1, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x20, DI + IMULQ R8, DI + SHRQ $0x36, DI + SHLQ $0x20, BX + IMULQ R8, BX + SHRQ $0x36, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeSnappyBlockAsm10B INCL CX JMP search_loop_encodeSnappyBlockAsm10B @@ -13537,8 +13518,8 @@ zero_loop_encodeSnappyBlockAsm8B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -13548,475 +13529,197 @@ zero_loop_encodeSnappyBlockAsm8B: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBlockAsm8B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x04, SI - LEAL 4(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x04, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm8B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x9e3779b1, R9 - MOVQ DI, R10 - MOVQ DI, R11 - SHRQ $0x08, R11 + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x9e3779b1, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x38, R9 SHLQ $0x20, R10 - IMULQ R9, R10 + IMULQ R8, R10 SHRQ $0x38, R10 - SHLQ $0x20, R11 - IMULQ R9, R11 - SHRQ $0x38, R11 - MOVL 24(SP)(R10*4), SI - MOVL 24(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - LEAL 1(CX), R10 - MOVL R10, 24(SP)(R11*4) - MOVQ DI, R10 - SHRQ $0x10, R10 - SHLQ $0x20, R10 - IMULQ R9, R10 - SHRQ $0x38, R10 - MOVL CX, R9 - SUBL 16(SP), R9 - MOVL 1(DX)(R9*1), R11 - MOVQ DI, R9 - SHRQ $0x08, R9 - CMPL R9, R11 - JNE no_repeat_found_encodeSnappyBlockAsm8B - LEAL 1(CX), DI - MOVL 12(SP), SI - MOVL DI, R8 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x38, R9 + MOVL CX, R8 SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_encodeSnappyBlockAsm8B + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI JZ repeat_extend_back_end_encodeSnappyBlockAsm8B repeat_extend_back_loop_encodeSnappyBlockAsm8B: - CMPL DI, SI + CMPL SI, BX JLE repeat_extend_back_end_encodeSnappyBlockAsm8B - MOVB -1(DX)(R8*1), BL - MOVB -1(DX)(DI*1), R9 - CMPB BL, R9 + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 JNE repeat_extend_back_end_encodeSnappyBlockAsm8B - LEAL -1(DI), DI - DECL R8 + LEAL -1(SI), SI + DECL DI JNZ repeat_extend_back_loop_encodeSnappyBlockAsm8B repeat_extend_back_end_encodeSnappyBlockAsm8B: - MOVL 12(SP), SI - CMPL SI, DI + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_repeat_emit_encodeSnappyBlockAsm8B - MOVL DI, R8 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R9 - SUBL SI, R8 - LEAL -1(R8), SI - CMPL SI, $0x3c + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c JLT one_byte_repeat_emit_encodeSnappyBlockAsm8B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_repeat_emit_encodeSnappyBlockAsm8B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_repeat_emit_encodeSnappyBlockAsm8B two_bytes_repeat_emit_encodeSnappyBlockAsm8B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_repeat_emit_encodeSnappyBlockAsm8B JMP memmove_long_repeat_emit_encodeSnappyBlockAsm8B one_byte_repeat_emit_encodeSnappyBlockAsm8B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_repeat_emit_encodeSnappyBlockAsm8B: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveShort - CMPQ R8, $0x08 + CMPQ DI, $0x08 JLE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_8 - CMPQ R8, $0x10 + CMPQ DI, $0x10 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_8through16 - CMPQ R8, $0x20 + CMPQ DI, $0x20 JBE emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_33through64 emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_8: - MOVQ (R9), R10 - MOVQ R10, (AX) + MOVQ (R8), R9 + MOVQ R9, (AX) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm8B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_8through16: - MOVQ (R9), R10 - MOVQ -8(R9)(R8*1), R9 - MOVQ R10, (AX) - MOVQ R9, -8(AX)(R8*1) + MOVQ (R8), R9 + MOVQ -8(R8)(DI*1), R8 + MOVQ R9, (AX) + MOVQ R8, -8(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm8B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_17through32: - MOVOU (R9), X0 - MOVOU -16(R9)(R8*1), X1 + MOVOU (R8), X0 + MOVOU -16(R8)(DI*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R8*1) + MOVOU X1, -16(AX)(DI*1) JMP memmove_end_copy_repeat_emit_encodeSnappyBlockAsm8B emit_lit_memmove_repeat_emit_encodeSnappyBlockAsm8B_memmove_move_33through64: - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) memmove_end_copy_repeat_emit_encodeSnappyBlockAsm8B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_repeat_emit_encodeSnappyBlockAsm8B memmove_long_repeat_emit_encodeSnappyBlockAsm8B: - LEAQ (AX)(R8*1), SI + LEAQ (AX)(DI*1), BX // genMemMoveLong - MOVOU (R9), X0 - MOVOU 16(R9), X1 - MOVOU -32(R9)(R8*1), X2 - MOVOU -16(R9)(R8*1), X3 - MOVQ R8, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 + MOVOU (R8), X0 + MOVOU 16(R8), X1 + MOVOU -32(R8)(DI*1), X2 + MOVOU -16(R8)(DI*1), X3 + MOVQ DI, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 JA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32 - LEAQ -32(R9)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 + LEAQ -32(R8)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm8Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) ADDQ $0x20, R12 - DECQ R11 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 JNA emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm8Blarge_big_loop_back emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32: - MOVOU -32(R9)(R12*1), X4 - MOVOU -16(R9)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R8, R12 + MOVOU -32(R8)(R11*1), X4 + MOVOU -16(R8)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ DI, R11 JAE emit_lit_memmove_long_repeat_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R8*1) - MOVOU X3, -16(AX)(R8*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(DI*1) + MOVOU X3, -16(AX)(DI*1) + MOVQ BX, AX emit_literal_done_repeat_emit_encodeSnappyBlockAsm8B: ADDL $0x05, CX - MOVL CX, SI - SUBL 16(SP), SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), SI - - // matchLen - XORL R11, R11 - CMPL R8, $0x08 - JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B - -matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B: - MOVQ (R9)(R11*1), R10 - XORQ (SI)(R11*1), R10 - TESTQ R10, R10 - JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm8B - -#ifdef GOAMD64_v3 - TZCNTQ R10, R10 - -#else - BSFQ R10, R10 - -#endif - SARQ $0x03, R10 - LEAL (R11)(R10*1), R11 - JMP repeat_extend_forward_end_encodeSnappyBlockAsm8B - -matchlen_loop_repeat_extend_encodeSnappyBlockAsm8B: - LEAL -8(R8), R8 - LEAL 8(R11), R11 - CMPL R8, $0x08 - JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B - JZ repeat_extend_forward_end_encodeSnappyBlockAsm8B - -matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B: - CMPL R8, $0x04 - JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B - MOVL (R9)(R11*1), R10 - CMPL (SI)(R11*1), R10 - JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B - SUBL $0x04, R8 - LEAL 4(R11), R11 - -matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B: - CMPL R8, $0x02 - JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B - MOVW (R9)(R11*1), R10 - CMPW (SI)(R11*1), R10 - JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B - SUBL $0x02, R8 - LEAL 2(R11), R11 - -matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B: - CMPL R8, $0x01 - JL repeat_extend_forward_end_encodeSnappyBlockAsm8B - MOVB (R9)(R11*1), R10 - CMPB (SI)(R11*1), R10 - JNE repeat_extend_forward_end_encodeSnappyBlockAsm8B - LEAL 1(R11), R11 - -repeat_extend_forward_end_encodeSnappyBlockAsm8B: - ADDL R11, CX - MOVL CX, SI - SUBL DI, SI - MOVL 16(SP), DI - - // emitCopy -two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm8B: - CMPL SI, $0x40 - JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm8B - MOVB $0xee, (AX) - MOVW DI, 1(AX) - LEAL -60(SI), SI - ADDQ $0x03, AX - JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm8B - -two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm8B: - CMPL SI, $0x0c - JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm8B - MOVB $0x01, BL - LEAL -16(BX)(SI*4), SI - MOVB DI, 1(AX) - SHRL $0x08, DI - SHLL $0x05, DI - ORL DI, SI - MOVB SI, (AX) - ADDQ $0x02, AX - JMP repeat_end_emit_encodeSnappyBlockAsm8B - -emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm8B: - MOVB $0x02, BL - LEAL -4(BX)(SI*4), SI - MOVB SI, (AX) - MOVW DI, 1(AX) - ADDQ $0x03, AX - -repeat_end_emit_encodeSnappyBlockAsm8B: - MOVL CX, 12(SP) - JMP search_loop_encodeSnappyBlockAsm8B - -no_repeat_found_encodeSnappyBlockAsm8B: - CMPL (DX)(SI*1), DI - JEQ candidate_match_encodeSnappyBlockAsm8B - SHRQ $0x08, DI - MOVL 24(SP)(R10*4), SI - LEAL 2(CX), R9 - CMPL (DX)(R8*1), DI - JEQ candidate2_match_encodeSnappyBlockAsm8B - MOVL R9, 24(SP)(R10*4) - SHRQ $0x08, DI - CMPL (DX)(SI*1), DI - JEQ candidate3_match_encodeSnappyBlockAsm8B - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBlockAsm8B - -candidate3_match_encodeSnappyBlockAsm8B: - ADDL $0x02, CX - JMP candidate_match_encodeSnappyBlockAsm8B - -candidate2_match_encodeSnappyBlockAsm8B: - MOVL R9, 24(SP)(R10*4) - INCL CX - MOVL R8, SI - -candidate_match_encodeSnappyBlockAsm8B: - MOVL 12(SP), DI - TESTL SI, SI - JZ match_extend_back_end_encodeSnappyBlockAsm8B - -match_extend_back_loop_encodeSnappyBlockAsm8B: - CMPL CX, DI - JLE match_extend_back_end_encodeSnappyBlockAsm8B - MOVB -1(DX)(SI*1), BL - MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 - JNE match_extend_back_end_encodeSnappyBlockAsm8B - LEAL -1(CX), CX - DECL SI - JZ match_extend_back_end_encodeSnappyBlockAsm8B - JMP match_extend_back_loop_encodeSnappyBlockAsm8B - -match_extend_back_end_encodeSnappyBlockAsm8B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) - JL match_dst_size_check_encodeSnappyBlockAsm8B - MOVQ $0x00000000, ret+48(FP) - RET - -match_dst_size_check_encodeSnappyBlockAsm8B: - MOVL CX, DI - MOVL 12(SP), R8 - CMPL R8, DI - JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm8B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(R8*1), DI - SUBL R8, R9 - LEAL -1(R9), R8 - CMPL R8, $0x3c - JLT one_byte_match_emit_encodeSnappyBlockAsm8B - CMPL R8, $0x00000100 - JLT two_bytes_match_emit_encodeSnappyBlockAsm8B - MOVB $0xf4, (AX) - MOVW R8, 1(AX) - ADDQ $0x03, AX - JMP memmove_long_match_emit_encodeSnappyBlockAsm8B - -two_bytes_match_emit_encodeSnappyBlockAsm8B: - MOVB $0xf0, (AX) - MOVB R8, 1(AX) - ADDQ $0x02, AX - CMPL R8, $0x40 - JL memmove_match_emit_encodeSnappyBlockAsm8B - JMP memmove_long_match_emit_encodeSnappyBlockAsm8B - -one_byte_match_emit_encodeSnappyBlockAsm8B: - SHLB $0x02, R8 - MOVB R8, (AX) - ADDQ $0x01, AX - -memmove_match_emit_encodeSnappyBlockAsm8B: - LEAQ (AX)(R9*1), R8 - - // genMemMoveShort - CMPQ R9, $0x08 - JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8 - CMPQ R9, $0x10 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8through16 - CMPQ R9, $0x20 - JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_17through32 - JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_33through64 - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8: - MOVQ (DI), R10 - MOVQ R10, (AX) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm8B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8through16: - MOVQ (DI), R10 - MOVQ -8(DI)(R9*1), DI - MOVQ R10, (AX) - MOVQ DI, -8(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm8B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_17through32: - MOVOU (DI), X0 - MOVOU -16(DI)(R9*1), X1 - MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) - JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm8B - -emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_33through64: - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - -memmove_end_copy_match_emit_encodeSnappyBlockAsm8B: - MOVQ R8, AX - JMP emit_literal_done_match_emit_encodeSnappyBlockAsm8B - -memmove_long_match_emit_encodeSnappyBlockAsm8B: - LEAQ (AX)(R9*1), R8 - - // genMemMoveLong - MOVOU (DI), X0 - MOVOU 16(DI), X1 - MOVOU -32(DI)(R9*1), X2 - MOVOU -16(DI)(R9*1), X3 - MOVQ R9, R11 - SHRQ $0x05, R11 - MOVQ AX, R10 - ANDL $0x0000001f, R10 - MOVQ $0x00000040, R12 - SUBQ R10, R12 - DECQ R11 - JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32 - LEAQ -32(DI)(R12*1), R10 - LEAQ -32(AX)(R12*1), R13 - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_big_loop_back: - MOVOU (R10), X4 - MOVOU 16(R10), X5 - MOVOA X4, (R13) - MOVOA X5, 16(R13) - ADDQ $0x20, R13 - ADDQ $0x20, R10 - ADDQ $0x20, R12 - DECQ R11 - JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_big_loop_back - -emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32: - MOVOU -32(DI)(R12*1), X4 - MOVOU -16(DI)(R12*1), X5 - MOVOA X4, -32(AX)(R12*1) - MOVOA X5, -16(AX)(R12*1) - ADDQ $0x20, R12 - CMPQ R9, R12 - JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32 - MOVOU X0, (AX) - MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ R8, AX - -emit_literal_done_match_emit_encodeSnappyBlockAsm8B: -match_nolit_loop_encodeSnappyBlockAsm8B: - MOVL CX, DI - SUBL SI, DI - MOVL DI, 16(SP) - ADDL $0x04, CX - ADDL $0x04, SI + MOVL CX, BX + SUBL 16(SP), BX MOVQ src_len+32(FP), DI SUBL CX, DI LEAQ (DX)(CX*1), R8 - LEAQ (DX)(SI*1), SI + LEAQ (DX)(BX*1), BX // matchLen XORL R10, R10 CMPL DI, $0x08 - JL matchlen_match4_match_nolit_encodeSnappyBlockAsm8B + JL matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B -matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B: +matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B: MOVQ (R8)(R10*1), R9 - XORQ (SI)(R10*1), R9 + XORQ (BX)(R10*1), R9 TESTQ R9, R9 - JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm8B + JZ matchlen_loop_repeat_extend_encodeSnappyBlockAsm8B #ifdef GOAMD64_v3 TZCNTQ R9, R9 @@ -14027,103 +13730,381 @@ matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B: #endif SARQ $0x03, R9 LEAL (R10)(R9*1), R10 - JMP match_nolit_end_encodeSnappyBlockAsm8B + JMP repeat_extend_forward_end_encodeSnappyBlockAsm8B -matchlen_loop_match_nolit_encodeSnappyBlockAsm8B: +matchlen_loop_repeat_extend_encodeSnappyBlockAsm8B: LEAL -8(DI), DI LEAL 8(R10), R10 CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B + JZ repeat_extend_forward_end_encodeSnappyBlockAsm8B + +matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B: + CMPL DI, $0x01 + JL repeat_extend_forward_end_encodeSnappyBlockAsm8B + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_encodeSnappyBlockAsm8B + LEAL 1(R10), R10 + +repeat_extend_forward_end_encodeSnappyBlockAsm8B: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy +two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm8B: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm8B + MOVB $0xee, (AX) + MOVW SI, 1(AX) + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_encodeSnappyBlockAsm8B + +two_byte_offset_short_repeat_as_copy_encodeSnappyBlockAsm8B: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm8B + LEAL -15(DI), DI + MOVB SI, 1(AX) + SHRL $0x08, SI + SHLL $0x05, SI + ORL SI, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP repeat_end_emit_encodeSnappyBlockAsm8B + +emit_copy_three_repeat_as_copy_encodeSnappyBlockAsm8B: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW SI, 1(AX) + ADDQ $0x03, AX + +repeat_end_emit_encodeSnappyBlockAsm8B: + MOVL CX, 12(SP) + JMP search_loop_encodeSnappyBlockAsm8B + +no_repeat_found_encodeSnappyBlockAsm8B: + CMPL (DX)(BX*1), SI + JEQ candidate_match_encodeSnappyBlockAsm8B + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_encodeSnappyBlockAsm8B + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_encodeSnappyBlockAsm8B + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBlockAsm8B + +candidate3_match_encodeSnappyBlockAsm8B: + ADDL $0x02, CX + JMP candidate_match_encodeSnappyBlockAsm8B + +candidate2_match_encodeSnappyBlockAsm8B: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_encodeSnappyBlockAsm8B: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_encodeSnappyBlockAsm8B + +match_extend_back_loop_encodeSnappyBlockAsm8B: + CMPL CX, SI + JLE match_extend_back_end_encodeSnappyBlockAsm8B + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_encodeSnappyBlockAsm8B + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_encodeSnappyBlockAsm8B + JMP match_extend_back_loop_encodeSnappyBlockAsm8B + +match_extend_back_end_encodeSnappyBlockAsm8B: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_encodeSnappyBlockAsm8B + MOVQ $0x00000000, ret+48(FP) + RET + +match_dst_size_check_encodeSnappyBlockAsm8B: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_encodeSnappyBlockAsm8B + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), DI + CMPL DI, $0x3c + JLT one_byte_match_emit_encodeSnappyBlockAsm8B + CMPL DI, $0x00000100 + JLT two_bytes_match_emit_encodeSnappyBlockAsm8B + MOVB $0xf4, (AX) + MOVW DI, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_match_emit_encodeSnappyBlockAsm8B + +two_bytes_match_emit_encodeSnappyBlockAsm8B: + MOVB $0xf0, (AX) + MOVB DI, 1(AX) + ADDQ $0x02, AX + CMPL DI, $0x40 + JL memmove_match_emit_encodeSnappyBlockAsm8B + JMP memmove_long_match_emit_encodeSnappyBlockAsm8B + +one_byte_match_emit_encodeSnappyBlockAsm8B: + SHLB $0x02, DI + MOVB DI, (AX) + ADDQ $0x01, AX + +memmove_match_emit_encodeSnappyBlockAsm8B: + LEAQ (AX)(R8*1), DI + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_17through32 + JMP emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_33through64 + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8: + MOVQ (SI), R9 + MOVQ R9, (AX) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm8B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_8through16: + MOVQ (SI), R9 + MOVQ -8(SI)(R8*1), SI + MOVQ R9, (AX) + MOVQ SI, -8(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm8B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_17through32: + MOVOU (SI), X0 + MOVOU -16(SI)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_match_emit_encodeSnappyBlockAsm8B + +emit_lit_memmove_match_emit_encodeSnappyBlockAsm8B_memmove_move_33through64: + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_match_emit_encodeSnappyBlockAsm8B: + MOVQ DI, AX + JMP emit_literal_done_match_emit_encodeSnappyBlockAsm8B + +memmove_long_match_emit_encodeSnappyBlockAsm8B: + LEAQ (AX)(R8*1), DI + + // genMemMoveLong + MOVOU (SI), X0 + MOVOU 16(SI), X1 + MOVOU -32(SI)(R8*1), X2 + MOVOU -16(SI)(R8*1), X3 + MOVQ R8, R10 + SHRQ $0x05, R10 + MOVQ AX, R9 + ANDL $0x0000001f, R9 + MOVQ $0x00000040, R11 + SUBQ R9, R11 + DECQ R10 + JA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32 + LEAQ -32(SI)(R11*1), R9 + LEAQ -32(AX)(R11*1), R12 + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_big_loop_back: + MOVOU (R9), X4 + MOVOU 16(R9), X5 + MOVOA X4, (R12) + MOVOA X5, 16(R12) + ADDQ $0x20, R12 + ADDQ $0x20, R9 + ADDQ $0x20, R11 + DECQ R10 + JNA emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_big_loop_back + +emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32: + MOVOU -32(SI)(R11*1), X4 + MOVOU -16(SI)(R11*1), X5 + MOVOA X4, -32(AX)(R11*1) + MOVOA X5, -16(AX)(R11*1) + ADDQ $0x20, R11 + CMPQ R8, R11 + JAE emit_lit_memmove_long_match_emit_encodeSnappyBlockAsm8Blarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ DI, AX + +emit_literal_done_match_emit_encodeSnappyBlockAsm8B: +match_nolit_loop_encodeSnappyBlockAsm8B: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+32(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_encodeSnappyBlockAsm8B + +matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_encodeSnappyBlockAsm8B + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_encodeSnappyBlockAsm8B + +matchlen_loop_match_nolit_encodeSnappyBlockAsm8B: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B JZ match_nolit_end_encodeSnappyBlockAsm8B matchlen_match4_match_nolit_encodeSnappyBlockAsm8B: - CMPL DI, $0x04 + CMPL SI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBlockAsm8B - MOVL (R8)(R10*1), R9 - CMPL (SI)(R10*1), R9 + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm8B - SUBL $0x04, DI - LEAL 4(R10), R10 + SUBL $0x04, SI + LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm8B: - CMPL DI, $0x02 + CMPL SI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBlockAsm8B - MOVW (R8)(R10*1), R9 - CMPW (SI)(R10*1), R9 + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm8B - SUBL $0x02, DI - LEAL 2(R10), R10 + SUBL $0x02, SI + LEAL 2(R9), R9 matchlen_match1_match_nolit_encodeSnappyBlockAsm8B: - CMPL DI, $0x01 + CMPL SI, $0x01 JL match_nolit_end_encodeSnappyBlockAsm8B - MOVB (R8)(R10*1), R9 - CMPB (SI)(R10*1), R9 + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm8B - LEAL 1(R10), R10 + LEAL 1(R9), R9 match_nolit_end_encodeSnappyBlockAsm8B: - ADDL R10, CX - MOVL 16(SP), SI - ADDL $0x04, R10 + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBlockAsm8B: - CMPL R10, $0x40 + CMPL R9, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBlockAsm8B MOVB $0xee, (AX) - MOVW SI, 1(AX) - LEAL -60(R10), R10 + MOVW BX, 1(AX) + LEAL -60(R9), R9 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBlockAsm8B two_byte_offset_short_match_nolit_encodeSnappyBlockAsm8B: - CMPL R10, $0x0c + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBlockAsm8B - MOVB $0x01, BL - LEAL -16(BX)(R10*4), R10 - MOVB SI, 1(AX) - SHRL $0x08, SI - SHLL $0x05, SI - ORL SI, R10 - MOVB R10, (AX) + LEAL -15(SI), SI + MOVB BL, 1(AX) + SHRL $0x08, BX + SHLL $0x05, BX + ORL BX, SI + MOVB SI, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBlockAsm8B emit_copy_three_match_nolit_encodeSnappyBlockAsm8B: - MOVB $0x02, BL - LEAL -4(BX)(R10*4), R10 - MOVB R10, (AX) - MOVW SI, 1(AX) + LEAL -2(SI), SI + MOVB SI, (AX) + MOVW BX, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBlockAsm8B: CMPL CX, 8(SP) JGE emit_remainder_encodeSnappyBlockAsm8B - MOVQ -2(DX)(CX*1), DI + MOVQ -2(DX)(CX*1), SI CMPQ AX, (SP) JL match_nolit_dst_ok_encodeSnappyBlockAsm8B MOVQ $0x00000000, ret+48(FP) RET match_nolit_dst_ok_encodeSnappyBlockAsm8B: - MOVQ $0x9e3779b1, R9 - MOVQ DI, R8 - SHRQ $0x10, DI - MOVQ DI, SI - SHLQ $0x20, R8 - IMULQ R9, R8 - SHRQ $0x38, R8 - SHLQ $0x20, SI - IMULQ R9, SI - SHRQ $0x38, SI - LEAL -2(CX), R9 - LEAQ 24(SP)(SI*4), R10 - MOVL (R10), SI - MOVL R9, 24(SP)(R8*4) - MOVL CX, (R10) - CMPL (DX)(SI*1), DI + MOVQ $0x9e3779b1, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x20, DI + IMULQ R8, DI + SHRQ $0x38, DI + SHLQ $0x20, BX + IMULQ R8, BX + SHRQ $0x38, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI JEQ match_nolit_loop_encodeSnappyBlockAsm8B INCL CX JMP search_loop_encodeSnappyBlockAsm8B @@ -14287,9 +14268,9 @@ emit_literal_done_emit_remainder_encodeSnappyBlockAsm8B: // func encodeSnappyBetterBlockAsm(dst []byte, src []byte) int // Requires: BMI, SSE2 -TEXT ·encodeSnappyBetterBlockAsm(SB), $327704-56 +TEXT ·encodeSnappyBetterBlockAsm(SB), $589848-56 MOVQ dst_base+0(FP), AX - MOVQ $0x00000a00, CX + MOVQ $0x00001200, CX LEAQ 24(SP), DX PXOR X0, X0 @@ -14308,8 +14289,8 @@ zero_loop_encodeSnappyBetterBlockAsm: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -14319,359 +14300,369 @@ zero_loop_encodeSnappyBetterBlockAsm: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBetterBlockAsm: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x07, SI - CMPL SI, $0x63 + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x07, BX + CMPL BX, $0x63 JLE check_maxskip_ok_encodeSnappyBetterBlockAsm - LEAL 100(CX), SI + LEAL 100(CX), BX JMP check_maxskip_cont_encodeSnappyBetterBlockAsm check_maxskip_ok_encodeSnappyBetterBlockAsm: - LEAL 1(CX)(SI*1), SI + LEAL 1(CX)(BX*1), BX check_maxskip_cont_encodeSnappyBetterBlockAsm: - CMPL SI, 8(SP) + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBetterBlockAsm - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x00cf1bbcdcbfa563, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 262168(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 262168(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x00cf1bbcdcbfa563, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x2f, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x32, R10 + MOVL 24(SP)(R9*4), BX + MOVL 524312(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 524312(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeSnappyBetterBlockAsm - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeSnappyBetterBlockAsm - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBetterBlockAsm + CMPQ R10, SI + JNE no_short_found_encodeSnappyBetterBlockAsm + MOVL DI, BX + JMP candidate_match_encodeSnappyBetterBlockAsm + +no_short_found_encodeSnappyBetterBlockAsm: + CMPL R9, SI + JEQ candidate_match_encodeSnappyBetterBlockAsm + CMPL R10, SI + JEQ candidateS_match_encodeSnappyBetterBlockAsm + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBetterBlockAsm candidateS_match_encodeSnappyBetterBlockAsm: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x2f, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeSnappyBetterBlockAsm DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeSnappyBetterBlockAsm: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm match_extend_back_loop_encodeSnappyBetterBlockAsm: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeSnappyBetterBlockAsm - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeSnappyBetterBlockAsm LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm JMP match_extend_back_loop_encodeSnappyBetterBlockAsm match_extend_back_end_encodeSnappyBetterBlockAsm: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 5(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 5(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeSnappyBetterBlockAsm MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeSnappyBetterBlockAsm: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeSnappyBetterBlockAsm matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm JZ match_nolit_end_encodeSnappyBetterBlockAsm matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeSnappyBetterBlockAsm - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeSnappyBetterBlockAsm: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - CMPL R12, $0x01 + CMPL R11, $0x01 JG match_length_ok_encodeSnappyBetterBlockAsm - CMPL R8, $0x0000ffff + CMPL DI, $0x0000ffff JLE match_length_ok_encodeSnappyBetterBlockAsm MOVL 20(SP), CX INCL CX JMP search_loop_encodeSnappyBetterBlockAsm match_length_ok_encodeSnappyBetterBlockAsm: - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeSnappyBetterBlockAsm - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeSnappyBetterBlockAsm - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeSnappyBetterBlockAsm - CMPL SI, $0x00010000 + CMPL BX, $0x00010000 JLT three_bytes_match_emit_encodeSnappyBetterBlockAsm - CMPL SI, $0x01000000 + CMPL BX, $0x01000000 JLT four_bytes_match_emit_encodeSnappyBetterBlockAsm MOVB $0xfc, (AX) - MOVL SI, 1(AX) + MOVL BX, 1(AX) ADDQ $0x05, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm four_bytes_match_emit_encodeSnappyBetterBlockAsm: - MOVL SI, R11 - SHRL $0x10, R11 + MOVL BX, R10 + SHRL $0x10, R10 MOVB $0xf8, (AX) - MOVW SI, 1(AX) - MOVB R11, 3(AX) + MOVW BX, 1(AX) + MOVB R10, 3(AX) ADDQ $0x04, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm three_bytes_match_emit_encodeSnappyBetterBlockAsm: MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm two_bytes_match_emit_encodeSnappyBetterBlockAsm: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeSnappyBetterBlockAsm JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm one_byte_match_emit_encodeSnappyBetterBlockAsm: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeSnappyBetterBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_33through64 emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeSnappyBetterBlockAsm memmove_long_match_emit_encodeSnappyBetterBlockAsm: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsmlarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsmlarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsmlarge_big_loop_back emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsmlarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsmlarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeSnappyBetterBlockAsm: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy - CMPL R8, $0x00010000 + CMPL DI, $0x00010000 JL two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm four_bytes_loop_back_match_nolit_encodeSnappyBetterBlockAsm: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE four_bytes_remain_match_nolit_encodeSnappyBetterBlockAsm MOVB $0xff, (AX) - MOVL R8, 1(AX) - LEAL -64(R12), R12 + MOVL DI, 1(AX) + LEAL -64(R11), R11 ADDQ $0x05, AX - CMPL R12, $0x04 + CMPL R11, $0x04 JL four_bytes_remain_match_nolit_encodeSnappyBetterBlockAsm JMP four_bytes_loop_back_match_nolit_encodeSnappyBetterBlockAsm four_bytes_remain_match_nolit_encodeSnappyBetterBlockAsm: - TESTL R12, R12 + TESTL R11, R11 JZ match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm - MOVB $0x03, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVL R8, 1(AX) + XORL BX, BX + LEAL -1(BX)(R11*4), R11 + MOVB R11, (AX) + MOVL DI, 1(AX) ADDQ $0x05, AX JMP match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm: @@ -14683,54 +14674,51 @@ match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm: RET match_nolit_dst_ok_encodeSnappyBetterBlockAsm: - MOVQ $0x00cf1bbcdcbfa563, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 + MOVQ $0x00cf1bbcdcbfa563, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x2f, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x32, R10 + SHLQ $0x08, R11 + IMULQ BX, R11 + SHRQ $0x2f, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x32, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 262168(SP)(R11*4) - MOVL R15, 262168(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 262168(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeSnappyBetterBlockAsm + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 524312(SP)(R10*4) + MOVL R13, 524312(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeSnappyBetterBlockAsm: + CMPQ SI, R8 + JAE search_loop_encodeSnappyBetterBlockAsm + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x08, DI + IMULQ BX, DI + SHRQ $0x2f, DI + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x2f, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeSnappyBetterBlockAsm emit_remainder_encodeSnappyBetterBlockAsm: MOVQ src_len+32(FP), CX @@ -14931,8 +14919,8 @@ zero_loop_encodeSnappyBetterBlockAsm64K: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -14942,299 +14930,309 @@ zero_loop_encodeSnappyBetterBlockAsm64K: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBetterBlockAsm64K: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x07, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x07, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBetterBlockAsm64K - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x00cf1bbcdcbfa563, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x32, R11 - MOVL 24(SP)(R10*4), SI - MOVL 262168(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 262168(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x00cf1bbcdcbfa563, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x30, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x32, R10 + MOVL 24(SP)(R9*4), BX + MOVL 262168(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 262168(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeSnappyBetterBlockAsm64K - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeSnappyBetterBlockAsm64K - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBetterBlockAsm64K + CMPQ R10, SI + JNE no_short_found_encodeSnappyBetterBlockAsm64K + MOVL DI, BX + JMP candidate_match_encodeSnappyBetterBlockAsm64K + +no_short_found_encodeSnappyBetterBlockAsm64K: + CMPL R9, SI + JEQ candidate_match_encodeSnappyBetterBlockAsm64K + CMPL R10, SI + JEQ candidateS_match_encodeSnappyBetterBlockAsm64K + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBetterBlockAsm64K candidateS_match_encodeSnappyBetterBlockAsm64K: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x08, R10 - IMULQ R9, R10 - SHRQ $0x30, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x08, R9 + IMULQ R8, R9 + SHRQ $0x30, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeSnappyBetterBlockAsm64K DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeSnappyBetterBlockAsm64K: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm64K match_extend_back_loop_encodeSnappyBetterBlockAsm64K: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeSnappyBetterBlockAsm64K - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeSnappyBetterBlockAsm64K LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm64K JMP match_extend_back_loop_encodeSnappyBetterBlockAsm64K match_extend_back_end_encodeSnappyBetterBlockAsm64K: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeSnappyBetterBlockAsm64K MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeSnappyBetterBlockAsm64K: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm64K matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm64K: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm64K #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeSnappyBetterBlockAsm64K matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm64K: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm64K JZ match_nolit_end_encodeSnappyBetterBlockAsm64K matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeSnappyBetterBlockAsm64K - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm64K - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeSnappyBetterBlockAsm64K: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeSnappyBetterBlockAsm64K - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeSnappyBetterBlockAsm64K - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeSnappyBetterBlockAsm64K MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm64K two_bytes_match_emit_encodeSnappyBetterBlockAsm64K: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeSnappyBetterBlockAsm64K JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm64K one_byte_match_emit_encodeSnappyBetterBlockAsm64K: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeSnappyBetterBlockAsm64K: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_33through64 emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm64K emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm64K emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm64K emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm64K_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm64K: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeSnappyBetterBlockAsm64K memmove_long_match_emit_encodeSnappyBetterBlockAsm64K: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm64Klarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm64Klarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm64Klarge_big_loop_back emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm64Klarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm64Klarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeSnappyBetterBlockAsm64K: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm64K MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm64K two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm64K - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm64K - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm64K emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm64K: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm64K: @@ -15246,54 +15244,51 @@ match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm64K: RET match_nolit_dst_ok_encodeSnappyBetterBlockAsm64K: - MOVQ $0x00cf1bbcdcbfa563, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 + MOVQ $0x00cf1bbcdcbfa563, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x30, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x32, R10 + SHLQ $0x08, R11 + IMULQ BX, R11 + SHRQ $0x30, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x32, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 262168(SP)(R11*4) - MOVL R15, 262168(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x08, R10 - IMULQ SI, R10 - SHRQ $0x30, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x32, R11 - SHLQ $0x08, R13 - IMULQ SI, R13 - SHRQ $0x30, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 262168(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeSnappyBetterBlockAsm64K + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 262168(SP)(R10*4) + MOVL R13, 262168(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeSnappyBetterBlockAsm64K: + CMPQ SI, R8 + JAE search_loop_encodeSnappyBetterBlockAsm64K + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x08, DI + IMULQ BX, DI + SHRQ $0x30, DI + SHLQ $0x08, R9 + IMULQ BX, R9 + SHRQ $0x30, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeSnappyBetterBlockAsm64K emit_remainder_encodeSnappyBetterBlockAsm64K: MOVQ src_len+32(FP), CX @@ -15475,8 +15470,8 @@ zero_loop_encodeSnappyBetterBlockAsm12B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -15486,299 +15481,309 @@ zero_loop_encodeSnappyBetterBlockAsm12B: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBetterBlockAsm12B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x06, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x06, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBetterBlockAsm12B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x34, R11 - MOVL 24(SP)(R10*4), SI - MOVL 65560(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 65560(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x34, R10 + MOVL 24(SP)(R9*4), BX + MOVL 65560(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 65560(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeSnappyBetterBlockAsm12B - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeSnappyBetterBlockAsm12B - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBetterBlockAsm12B + CMPQ R10, SI + JNE no_short_found_encodeSnappyBetterBlockAsm12B + MOVL DI, BX + JMP candidate_match_encodeSnappyBetterBlockAsm12B + +no_short_found_encodeSnappyBetterBlockAsm12B: + CMPL R9, SI + JEQ candidate_match_encodeSnappyBetterBlockAsm12B + CMPL R10, SI + JEQ candidateS_match_encodeSnappyBetterBlockAsm12B + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBetterBlockAsm12B candidateS_match_encodeSnappyBetterBlockAsm12B: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x32, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x32, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeSnappyBetterBlockAsm12B DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeSnappyBetterBlockAsm12B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm12B match_extend_back_loop_encodeSnappyBetterBlockAsm12B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeSnappyBetterBlockAsm12B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeSnappyBetterBlockAsm12B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm12B JMP match_extend_back_loop_encodeSnappyBetterBlockAsm12B match_extend_back_end_encodeSnappyBetterBlockAsm12B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeSnappyBetterBlockAsm12B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeSnappyBetterBlockAsm12B: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm12B matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm12B: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm12B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeSnappyBetterBlockAsm12B matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm12B: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm12B JZ match_nolit_end_encodeSnappyBetterBlockAsm12B matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeSnappyBetterBlockAsm12B - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm12B - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeSnappyBetterBlockAsm12B: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeSnappyBetterBlockAsm12B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeSnappyBetterBlockAsm12B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeSnappyBetterBlockAsm12B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm12B two_bytes_match_emit_encodeSnappyBetterBlockAsm12B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeSnappyBetterBlockAsm12B JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm12B one_byte_match_emit_encodeSnappyBetterBlockAsm12B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeSnappyBetterBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm12B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm12B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm12B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm12B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm12B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeSnappyBetterBlockAsm12B memmove_long_match_emit_encodeSnappyBetterBlockAsm12B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm12Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm12Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm12Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm12Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm12Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeSnappyBetterBlockAsm12B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm12B MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm12B two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm12B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm12B - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm12B emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm12B: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm12B: @@ -15790,54 +15795,51 @@ match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm12B: RET match_nolit_dst_ok_encodeSnappyBetterBlockAsm12B: - MOVQ $0x0000cf1bbcdcbf9b, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x32, R10 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x32, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x34, R11 + MOVQ $0x0000cf1bbcdcbf9b, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x32, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x34, R10 + SHLQ $0x10, R11 + IMULQ BX, R11 + SHRQ $0x32, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x34, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 65560(SP)(R11*4) - MOVL R15, 65560(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x32, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x34, R11 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x32, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 65560(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeSnappyBetterBlockAsm12B + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 65560(SP)(R10*4) + MOVL R13, 65560(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeSnappyBetterBlockAsm12B: + CMPQ SI, R8 + JAE search_loop_encodeSnappyBetterBlockAsm12B + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x10, DI + IMULQ BX, DI + SHRQ $0x32, DI + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x32, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeSnappyBetterBlockAsm12B emit_remainder_encodeSnappyBetterBlockAsm12B: MOVQ src_len+32(FP), CX @@ -16019,8 +16021,8 @@ zero_loop_encodeSnappyBetterBlockAsm10B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -16030,299 +16032,309 @@ zero_loop_encodeSnappyBetterBlockAsm10B: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBetterBlockAsm10B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x05, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBetterBlockAsm10B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x34, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x36, R11 - MOVL 24(SP)(R10*4), SI - MOVL 16408(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 16408(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x36, R10 + MOVL 24(SP)(R9*4), BX + MOVL 16408(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 16408(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeSnappyBetterBlockAsm10B - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeSnappyBetterBlockAsm10B - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBetterBlockAsm10B + CMPQ R10, SI + JNE no_short_found_encodeSnappyBetterBlockAsm10B + MOVL DI, BX + JMP candidate_match_encodeSnappyBetterBlockAsm10B + +no_short_found_encodeSnappyBetterBlockAsm10B: + CMPL R9, SI + JEQ candidate_match_encodeSnappyBetterBlockAsm10B + CMPL R10, SI + JEQ candidateS_match_encodeSnappyBetterBlockAsm10B + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBetterBlockAsm10B candidateS_match_encodeSnappyBetterBlockAsm10B: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x34, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x34, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeSnappyBetterBlockAsm10B DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeSnappyBetterBlockAsm10B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm10B match_extend_back_loop_encodeSnappyBetterBlockAsm10B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeSnappyBetterBlockAsm10B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeSnappyBetterBlockAsm10B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm10B JMP match_extend_back_loop_encodeSnappyBetterBlockAsm10B match_extend_back_end_encodeSnappyBetterBlockAsm10B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeSnappyBetterBlockAsm10B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeSnappyBetterBlockAsm10B: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm10B matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm10B: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm10B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeSnappyBetterBlockAsm10B matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm10B: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm10B JZ match_nolit_end_encodeSnappyBetterBlockAsm10B matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeSnappyBetterBlockAsm10B - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm10B - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeSnappyBetterBlockAsm10B: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeSnappyBetterBlockAsm10B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeSnappyBetterBlockAsm10B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeSnappyBetterBlockAsm10B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm10B two_bytes_match_emit_encodeSnappyBetterBlockAsm10B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeSnappyBetterBlockAsm10B JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm10B one_byte_match_emit_encodeSnappyBetterBlockAsm10B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeSnappyBetterBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm10B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm10B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm10B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm10B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm10B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeSnappyBetterBlockAsm10B memmove_long_match_emit_encodeSnappyBetterBlockAsm10B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm10Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm10Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm10Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm10Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm10Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeSnappyBetterBlockAsm10B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm10B MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm10B two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm10B - CMPL R8, $0x00000800 + CMPL DI, $0x00000800 JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm10B - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm10B emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm10B: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm10B: @@ -16334,54 +16346,51 @@ match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm10B: RET match_nolit_dst_ok_encodeSnappyBetterBlockAsm10B: - MOVQ $0x0000cf1bbcdcbf9b, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x34, R10 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x34, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x36, R11 + MOVQ $0x0000cf1bbcdcbf9b, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x34, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x36, R10 + SHLQ $0x10, R11 + IMULQ BX, R11 + SHRQ $0x34, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x36, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 16408(SP)(R11*4) - MOVL R15, 16408(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x34, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x36, R11 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x34, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 16408(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeSnappyBetterBlockAsm10B + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 16408(SP)(R10*4) + MOVL R13, 16408(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeSnappyBetterBlockAsm10B: + CMPQ SI, R8 + JAE search_loop_encodeSnappyBetterBlockAsm10B + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x10, DI + IMULQ BX, DI + SHRQ $0x34, DI + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x34, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeSnappyBetterBlockAsm10B emit_remainder_encodeSnappyBetterBlockAsm10B: MOVQ src_len+32(FP), CX @@ -16563,8 +16572,8 @@ zero_loop_encodeSnappyBetterBlockAsm8B: MOVL $0x00000000, 12(SP) MOVQ src_len+32(FP), CX LEAQ -9(CX), DX - LEAQ -8(CX), SI - MOVL SI, 8(SP) + LEAQ -8(CX), BX + MOVL BX, 8(SP) SHRQ $0x05, CX SUBL CX, DX LEAQ (AX)(DX*1), DX @@ -16574,297 +16583,307 @@ zero_loop_encodeSnappyBetterBlockAsm8B: MOVQ src_base+24(FP), DX search_loop_encodeSnappyBetterBlockAsm8B: - MOVL CX, SI - SUBL 12(SP), SI - SHRL $0x04, SI - LEAL 1(CX)(SI*1), SI - CMPL SI, 8(SP) + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x04, BX + LEAL 1(CX)(BX*1), BX + CMPL BX, 8(SP) JGE emit_remainder_encodeSnappyBetterBlockAsm8B - MOVQ (DX)(CX*1), DI - MOVL SI, 20(SP) - MOVQ $0x0000cf1bbcdcbf9b, R9 - MOVQ $0x9e3779b1, SI - MOVQ DI, R10 - MOVQ DI, R11 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x36, R10 - SHLQ $0x20, R11 - IMULQ SI, R11 - SHRQ $0x38, R11 - MOVL 24(SP)(R10*4), SI - MOVL 4120(SP)(R11*4), R8 - MOVL CX, 24(SP)(R10*4) - MOVL CX, 4120(SP)(R11*4) - CMPL (DX)(SI*1), DI + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ $0x9e3779b1, BX + MOVQ SI, R9 + MOVQ SI, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 + SHLQ $0x20, R10 + IMULQ BX, R10 + SHRQ $0x38, R10 + MOVL 24(SP)(R9*4), BX + MOVL 4120(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + MOVL CX, 4120(SP)(R10*4) + MOVQ (DX)(BX*1), R9 + MOVQ (DX)(DI*1), R10 + CMPQ R9, SI JEQ candidate_match_encodeSnappyBetterBlockAsm8B - CMPL (DX)(R8*1), DI - JEQ candidateS_match_encodeSnappyBetterBlockAsm8B - MOVL 20(SP), CX - JMP search_loop_encodeSnappyBetterBlockAsm8B + CMPQ R10, SI + JNE no_short_found_encodeSnappyBetterBlockAsm8B + MOVL DI, BX + JMP candidate_match_encodeSnappyBetterBlockAsm8B + +no_short_found_encodeSnappyBetterBlockAsm8B: + CMPL R9, SI + JEQ candidate_match_encodeSnappyBetterBlockAsm8B + CMPL R10, SI + JEQ candidateS_match_encodeSnappyBetterBlockAsm8B + MOVL 20(SP), CX + JMP search_loop_encodeSnappyBetterBlockAsm8B candidateS_match_encodeSnappyBetterBlockAsm8B: - SHRQ $0x08, DI - MOVQ DI, R10 - SHLQ $0x10, R10 - IMULQ R9, R10 - SHRQ $0x36, R10 - MOVL 24(SP)(R10*4), SI + SHRQ $0x08, SI + MOVQ SI, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x36, R9 + MOVL 24(SP)(R9*4), BX INCL CX - MOVL CX, 24(SP)(R10*4) - CMPL (DX)(SI*1), DI + MOVL CX, 24(SP)(R9*4) + CMPL (DX)(BX*1), SI JEQ candidate_match_encodeSnappyBetterBlockAsm8B DECL CX - MOVL R8, SI + MOVL DI, BX candidate_match_encodeSnappyBetterBlockAsm8B: - MOVL 12(SP), DI - TESTL SI, SI + MOVL 12(SP), SI + TESTL BX, BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm8B match_extend_back_loop_encodeSnappyBetterBlockAsm8B: - CMPL CX, DI + CMPL CX, SI JLE match_extend_back_end_encodeSnappyBetterBlockAsm8B - MOVB -1(DX)(SI*1), BL + MOVB -1(DX)(BX*1), DI MOVB -1(DX)(CX*1), R8 - CMPB BL, R8 + CMPB DI, R8 JNE match_extend_back_end_encodeSnappyBetterBlockAsm8B LEAL -1(CX), CX - DECL SI + DECL BX JZ match_extend_back_end_encodeSnappyBetterBlockAsm8B JMP match_extend_back_loop_encodeSnappyBetterBlockAsm8B match_extend_back_end_encodeSnappyBetterBlockAsm8B: - MOVL CX, DI - SUBL 12(SP), DI - LEAQ 3(AX)(DI*1), DI - CMPQ DI, (SP) + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) JL match_dst_size_check_encodeSnappyBetterBlockAsm8B MOVQ $0x00000000, ret+48(FP) RET match_dst_size_check_encodeSnappyBetterBlockAsm8B: - MOVL CX, DI + MOVL CX, SI ADDL $0x04, CX - ADDL $0x04, SI - MOVQ src_len+32(FP), R8 - SUBL CX, R8 - LEAQ (DX)(CX*1), R9 - LEAQ (DX)(SI*1), R10 + ADDL $0x04, BX + MOVQ src_len+32(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), R9 // matchLen - XORL R12, R12 - CMPL R8, $0x08 + XORL R11, R11 + CMPL DI, $0x08 JL matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm8B matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm8B: - MOVQ (R9)(R12*1), R11 - XORQ (R10)(R12*1), R11 - TESTQ R11, R11 + MOVQ (R8)(R11*1), R10 + XORQ (R9)(R11*1), R10 + TESTQ R10, R10 JZ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm8B #ifdef GOAMD64_v3 - TZCNTQ R11, R11 + TZCNTQ R10, R10 #else - BSFQ R11, R11 + BSFQ R10, R10 #endif - SARQ $0x03, R11 - LEAL (R12)(R11*1), R12 + SARQ $0x03, R10 + LEAL (R11)(R10*1), R11 JMP match_nolit_end_encodeSnappyBetterBlockAsm8B matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm8B: - LEAL -8(R8), R8 - LEAL 8(R12), R12 - CMPL R8, $0x08 + LEAL -8(DI), DI + LEAL 8(R11), R11 + CMPL DI, $0x08 JGE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm8B JZ match_nolit_end_encodeSnappyBetterBlockAsm8B matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL R8, $0x04 + CMPL DI, $0x04 JL matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B - MOVL (R9)(R12*1), R11 - CMPL (R10)(R12*1), R11 + MOVL (R8)(R11*1), R10 + CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B - SUBL $0x04, R8 - LEAL 4(R12), R12 + SUBL $0x04, DI + LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL R8, $0x02 + CMPL DI, $0x02 JL matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B - MOVW (R9)(R12*1), R11 - CMPW (R10)(R12*1), R11 + MOVW (R8)(R11*1), R10 + CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B - SUBL $0x02, R8 - LEAL 2(R12), R12 + SUBL $0x02, DI + LEAL 2(R11), R11 matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL R8, $0x01 + CMPL DI, $0x01 JL match_nolit_end_encodeSnappyBetterBlockAsm8B - MOVB (R9)(R12*1), R11 - CMPB (R10)(R12*1), R11 + MOVB (R8)(R11*1), R10 + CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm8B - LEAL 1(R12), R12 + LEAL 1(R11), R11 match_nolit_end_encodeSnappyBetterBlockAsm8B: - MOVL CX, R8 - SUBL SI, R8 + MOVL CX, DI + SUBL BX, DI // Check if repeat - MOVL R8, 16(SP) - MOVL 12(SP), SI - CMPL SI, DI + MOVL DI, 16(SP) + MOVL 12(SP), BX + CMPL BX, SI JEQ emit_literal_done_match_emit_encodeSnappyBetterBlockAsm8B - MOVL DI, R9 - MOVL DI, 12(SP) - LEAQ (DX)(SI*1), R10 - SUBL SI, R9 - LEAL -1(R9), SI - CMPL SI, $0x3c + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R9 + SUBL BX, R8 + LEAL -1(R8), BX + CMPL BX, $0x3c JLT one_byte_match_emit_encodeSnappyBetterBlockAsm8B - CMPL SI, $0x00000100 + CMPL BX, $0x00000100 JLT two_bytes_match_emit_encodeSnappyBetterBlockAsm8B MOVB $0xf4, (AX) - MOVW SI, 1(AX) + MOVW BX, 1(AX) ADDQ $0x03, AX JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm8B two_bytes_match_emit_encodeSnappyBetterBlockAsm8B: MOVB $0xf0, (AX) - MOVB SI, 1(AX) + MOVB BL, 1(AX) ADDQ $0x02, AX - CMPL SI, $0x40 + CMPL BX, $0x40 JL memmove_match_emit_encodeSnappyBetterBlockAsm8B JMP memmove_long_match_emit_encodeSnappyBetterBlockAsm8B one_byte_match_emit_encodeSnappyBetterBlockAsm8B: - SHLB $0x02, SI - MOVB SI, (AX) + SHLB $0x02, BL + MOVB BL, (AX) ADDQ $0x01, AX memmove_match_emit_encodeSnappyBetterBlockAsm8B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveShort - CMPQ R9, $0x08 + CMPQ R8, $0x08 JLE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_8 - CMPQ R9, $0x10 + CMPQ R8, $0x10 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_8through16 - CMPQ R9, $0x20 + CMPQ R8, $0x20 JBE emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_17through32 JMP emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_33through64 emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_8: - MOVQ (R10), R11 - MOVQ R11, (AX) + MOVQ (R9), R10 + MOVQ R10, (AX) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm8B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_8through16: - MOVQ (R10), R11 - MOVQ -8(R10)(R9*1), R10 - MOVQ R11, (AX) - MOVQ R10, -8(AX)(R9*1) + MOVQ (R9), R10 + MOVQ -8(R9)(R8*1), R9 + MOVQ R10, (AX) + MOVQ R9, -8(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm8B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_17through32: - MOVOU (R10), X0 - MOVOU -16(R10)(R9*1), X1 + MOVOU (R9), X0 + MOVOU -16(R9)(R8*1), X1 MOVOU X0, (AX) - MOVOU X1, -16(AX)(R9*1) + MOVOU X1, -16(AX)(R8*1) JMP memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm8B emit_lit_memmove_match_emit_encodeSnappyBetterBlockAsm8B_memmove_move_33through64: - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) memmove_end_copy_match_emit_encodeSnappyBetterBlockAsm8B: - MOVQ SI, AX + MOVQ BX, AX JMP emit_literal_done_match_emit_encodeSnappyBetterBlockAsm8B memmove_long_match_emit_encodeSnappyBetterBlockAsm8B: - LEAQ (AX)(R9*1), SI + LEAQ (AX)(R8*1), BX // genMemMoveLong - MOVOU (R10), X0 - MOVOU 16(R10), X1 - MOVOU -32(R10)(R9*1), X2 - MOVOU -16(R10)(R9*1), X3 - MOVQ R9, R13 - SHRQ $0x05, R13 - MOVQ AX, R11 - ANDL $0x0000001f, R11 - MOVQ $0x00000040, R14 - SUBQ R11, R14 - DECQ R13 + MOVOU (R9), X0 + MOVOU 16(R9), X1 + MOVOU -32(R9)(R8*1), X2 + MOVOU -16(R9)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R10 + ANDL $0x0000001f, R10 + MOVQ $0x00000040, R13 + SUBQ R10, R13 + DECQ R12 JA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm8Blarge_forward_sse_loop_32 - LEAQ -32(R10)(R14*1), R11 - LEAQ -32(AX)(R14*1), R15 + LEAQ -32(R9)(R13*1), R10 + LEAQ -32(AX)(R13*1), R14 emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm8Blarge_big_loop_back: - MOVOU (R11), X4 - MOVOU 16(R11), X5 - MOVOA X4, (R15) - MOVOA X5, 16(R15) - ADDQ $0x20, R15 - ADDQ $0x20, R11 + MOVOU (R10), X4 + MOVOU 16(R10), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) ADDQ $0x20, R14 - DECQ R13 + ADDQ $0x20, R10 + ADDQ $0x20, R13 + DECQ R12 JNA emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm8Blarge_big_loop_back emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm8Blarge_forward_sse_loop_32: - MOVOU -32(R10)(R14*1), X4 - MOVOU -16(R10)(R14*1), X5 - MOVOA X4, -32(AX)(R14*1) - MOVOA X5, -16(AX)(R14*1) - ADDQ $0x20, R14 - CMPQ R9, R14 + MOVOU -32(R9)(R13*1), X4 + MOVOU -16(R9)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 JAE emit_lit_memmove_long_match_emit_encodeSnappyBetterBlockAsm8Blarge_forward_sse_loop_32 MOVOU X0, (AX) MOVOU X1, 16(AX) - MOVOU X2, -32(AX)(R9*1) - MOVOU X3, -16(AX)(R9*1) - MOVQ SI, AX + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ BX, AX emit_literal_done_match_emit_encodeSnappyBetterBlockAsm8B: - ADDL R12, CX - ADDL $0x04, R12 + ADDL R11, CX + ADDL $0x04, R11 MOVL CX, 12(SP) // emitCopy two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL R12, $0x40 + CMPL R11, $0x40 JLE two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm8B MOVB $0xee, (AX) - MOVW R8, 1(AX) - LEAL -60(R12), R12 + MOVW DI, 1(AX) + LEAL -60(R11), R11 ADDQ $0x03, AX JMP two_byte_offset_match_nolit_encodeSnappyBetterBlockAsm8B two_byte_offset_short_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL R12, $0x0c + MOVL R11, BX + SHLL $0x02, BX + CMPL R11, $0x0c JGE emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm8B - MOVB $0x01, BL - LEAL -16(BX)(R12*4), R12 - MOVB R8, 1(AX) - SHRL $0x08, R8 - SHLL $0x05, R8 - ORL R8, R12 - MOVB R12, (AX) + LEAL -15(BX), BX + MOVB DI, 1(AX) + SHRL $0x08, DI + SHLL $0x05, DI + ORL DI, BX + MOVB BL, (AX) ADDQ $0x02, AX JMP match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm8B emit_copy_three_match_nolit_encodeSnappyBetterBlockAsm8B: - MOVB $0x02, BL - LEAL -4(BX)(R12*4), R12 - MOVB R12, (AX) - MOVW R8, 1(AX) + LEAL -2(BX), BX + MOVB BL, (AX) + MOVW DI, 1(AX) ADDQ $0x03, AX match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm8B: @@ -16876,54 +16895,51 @@ match_nolit_emitcopy_end_encodeSnappyBetterBlockAsm8B: RET match_nolit_dst_ok_encodeSnappyBetterBlockAsm8B: - MOVQ $0x0000cf1bbcdcbf9b, SI - MOVQ $0x9e3779b1, R8 - INCL DI - MOVQ (DX)(DI*1), R9 - MOVQ R9, R10 - MOVQ R9, R11 - MOVQ R9, R12 - SHRQ $0x08, R11 - MOVQ R11, R13 - SHRQ $0x10, R12 - LEAL 1(DI), R14 - LEAL 2(DI), R15 - MOVQ -2(DX)(CX*1), R9 - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x36, R10 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x36, R13 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x38, R11 + MOVQ $0x0000cf1bbcdcbf9b, BX + MOVQ $0x9e3779b1, DI + LEAQ 1(SI), SI + LEAQ -2(CX), R8 + MOVQ (DX)(SI*1), R9 + MOVQ 1(DX)(SI*1), R10 + MOVQ (DX)(R8*1), R11 + MOVQ 1(DX)(R8*1), R12 + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x36, R9 + SHLQ $0x20, R10 + IMULQ DI, R10 + SHRQ $0x38, R10 + SHLQ $0x10, R11 + IMULQ BX, R11 + SHRQ $0x36, R11 SHLQ $0x20, R12 - IMULQ R8, R12 + IMULQ DI, R12 SHRQ $0x38, R12 - MOVL DI, 24(SP)(R10*4) - MOVL R14, 24(SP)(R13*4) - MOVL R14, 4120(SP)(R11*4) - MOVL R15, 4120(SP)(R12*4) - MOVQ R9, R10 - MOVQ R9, R11 - SHRQ $0x08, R11 - MOVQ R11, R13 - LEAL -2(CX), R9 - LEAL -1(CX), DI - SHLQ $0x10, R10 - IMULQ SI, R10 - SHRQ $0x36, R10 - SHLQ $0x20, R11 - IMULQ R8, R11 - SHRQ $0x38, R11 - SHLQ $0x10, R13 - IMULQ SI, R13 - SHRQ $0x36, R13 - MOVL R9, 24(SP)(R10*4) - MOVL DI, 4120(SP)(R11*4) - MOVL DI, 24(SP)(R13*4) - JMP search_loop_encodeSnappyBetterBlockAsm8B + LEAQ 1(SI), DI + LEAQ 1(R8), R13 + MOVL SI, 24(SP)(R9*4) + MOVL R8, 24(SP)(R11*4) + MOVL DI, 4120(SP)(R10*4) + MOVL R13, 4120(SP)(R12*4) + ADDQ $0x01, SI + SUBQ $0x01, R8 + +index_loop_encodeSnappyBetterBlockAsm8B: + CMPQ SI, R8 + JAE search_loop_encodeSnappyBetterBlockAsm8B + MOVQ (DX)(SI*1), DI + MOVQ (DX)(R8*1), R9 + SHLQ $0x10, DI + IMULQ BX, DI + SHRQ $0x36, DI + SHLQ $0x10, R9 + IMULQ BX, R9 + SHRQ $0x36, R9 + MOVL SI, 24(SP)(DI*4) + MOVL R8, 24(SP)(R9*4) + ADDQ $0x02, SI + SUBQ $0x02, R8 + JMP index_loop_encodeSnappyBetterBlockAsm8B emit_remainder_encodeSnappyBetterBlockAsm8B: MOVQ src_len+32(FP), CX @@ -17082,6 +17098,1008 @@ emit_literal_done_emit_remainder_encodeSnappyBetterBlockAsm8B: MOVQ AX, ret+48(FP) RET +// func calcBlockSize(src []byte) int +// Requires: BMI, SSE2 +TEXT ·calcBlockSize(SB), $32792-32 + XORQ AX, AX + MOVQ $0x00000100, CX + LEAQ 24(SP), DX + PXOR X0, X0 + +zero_loop_calcBlockSize: + MOVOU X0, (DX) + MOVOU X0, 16(DX) + MOVOU X0, 32(DX) + MOVOU X0, 48(DX) + MOVOU X0, 64(DX) + MOVOU X0, 80(DX) + MOVOU X0, 96(DX) + MOVOU X0, 112(DX) + ADDQ $0x80, DX + DECQ CX + JNZ zero_loop_calcBlockSize + MOVL $0x00000000, 12(SP) + MOVQ src_len+8(FP), CX + LEAQ -9(CX), DX + LEAQ -8(CX), BX + MOVL BX, 8(SP) + SHRQ $0x05, CX + SUBL CX, DX + LEAQ (AX)(DX*1), DX + MOVQ DX, (SP) + MOVL $0x00000001, CX + MOVL CX, 16(SP) + MOVQ src_base+0(FP), DX + +search_loop_calcBlockSize: + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x05, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) + JGE emit_remainder_calcBlockSize + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x33, R9 + SHLQ $0x10, R10 + IMULQ R8, R10 + SHRQ $0x33, R10 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x10, R9 + IMULQ R8, R9 + SHRQ $0x33, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_calcBlockSize + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI + JZ repeat_extend_back_end_calcBlockSize + +repeat_extend_back_loop_calcBlockSize: + CMPL SI, BX + JLE repeat_extend_back_end_calcBlockSize + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 + JNE repeat_extend_back_end_calcBlockSize + LEAL -1(SI), SI + DECL DI + JNZ repeat_extend_back_loop_calcBlockSize + +repeat_extend_back_end_calcBlockSize: + MOVL 12(SP), BX + CMPL BX, SI + JEQ emit_literal_done_repeat_emit_calcBlockSize + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c + JLT one_byte_repeat_emit_calcBlockSize + CMPL BX, $0x00000100 + JLT two_bytes_repeat_emit_calcBlockSize + CMPL BX, $0x00010000 + JLT three_bytes_repeat_emit_calcBlockSize + CMPL BX, $0x01000000 + JLT four_bytes_repeat_emit_calcBlockSize + ADDQ $0x05, AX + JMP memmove_long_repeat_emit_calcBlockSize + +four_bytes_repeat_emit_calcBlockSize: + ADDQ $0x04, AX + JMP memmove_long_repeat_emit_calcBlockSize + +three_bytes_repeat_emit_calcBlockSize: + ADDQ $0x03, AX + JMP memmove_long_repeat_emit_calcBlockSize + +two_bytes_repeat_emit_calcBlockSize: + ADDQ $0x02, AX + CMPL BX, $0x40 + JL memmove_repeat_emit_calcBlockSize + JMP memmove_long_repeat_emit_calcBlockSize + +one_byte_repeat_emit_calcBlockSize: + ADDQ $0x01, AX + +memmove_repeat_emit_calcBlockSize: + LEAQ (AX)(DI*1), AX + JMP emit_literal_done_repeat_emit_calcBlockSize + +memmove_long_repeat_emit_calcBlockSize: + LEAQ (AX)(DI*1), AX + +emit_literal_done_repeat_emit_calcBlockSize: + ADDL $0x05, CX + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+8(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R10, R10 + CMPL DI, $0x08 + JL matchlen_match4_repeat_extend_calcBlockSize + +matchlen_loopback_repeat_extend_calcBlockSize: + MOVQ (R8)(R10*1), R9 + XORQ (BX)(R10*1), R9 + TESTQ R9, R9 + JZ matchlen_loop_repeat_extend_calcBlockSize + +#ifdef GOAMD64_v3 + TZCNTQ R9, R9 + +#else + BSFQ R9, R9 + +#endif + SARQ $0x03, R9 + LEAL (R10)(R9*1), R10 + JMP repeat_extend_forward_end_calcBlockSize + +matchlen_loop_repeat_extend_calcBlockSize: + LEAL -8(DI), DI + LEAL 8(R10), R10 + CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_calcBlockSize + JZ repeat_extend_forward_end_calcBlockSize + +matchlen_match4_repeat_extend_calcBlockSize: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_calcBlockSize + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_calcBlockSize + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_calcBlockSize: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_calcBlockSize + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_calcBlockSize + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_calcBlockSize: + CMPL DI, $0x01 + JL repeat_extend_forward_end_calcBlockSize + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_calcBlockSize + LEAL 1(R10), R10 + +repeat_extend_forward_end_calcBlockSize: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy + CMPL SI, $0x00010000 + JL two_byte_offset_repeat_as_copy_calcBlockSize + +four_bytes_loop_back_repeat_as_copy_calcBlockSize: + CMPL BX, $0x40 + JLE four_bytes_remain_repeat_as_copy_calcBlockSize + LEAL -64(BX), BX + ADDQ $0x05, AX + CMPL BX, $0x04 + JL four_bytes_remain_repeat_as_copy_calcBlockSize + JMP four_bytes_loop_back_repeat_as_copy_calcBlockSize + +four_bytes_remain_repeat_as_copy_calcBlockSize: + TESTL BX, BX + JZ repeat_end_emit_calcBlockSize + XORL BX, BX + ADDQ $0x05, AX + JMP repeat_end_emit_calcBlockSize + +two_byte_offset_repeat_as_copy_calcBlockSize: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_calcBlockSize + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_calcBlockSize + +two_byte_offset_short_repeat_as_copy_calcBlockSize: + MOVL BX, DI + SHLL $0x02, DI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_calcBlockSize + CMPL SI, $0x00000800 + JGE emit_copy_three_repeat_as_copy_calcBlockSize + ADDQ $0x02, AX + JMP repeat_end_emit_calcBlockSize + +emit_copy_three_repeat_as_copy_calcBlockSize: + ADDQ $0x03, AX + +repeat_end_emit_calcBlockSize: + MOVL CX, 12(SP) + JMP search_loop_calcBlockSize + +no_repeat_found_calcBlockSize: + CMPL (DX)(BX*1), SI + JEQ candidate_match_calcBlockSize + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_calcBlockSize + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_calcBlockSize + MOVL 20(SP), CX + JMP search_loop_calcBlockSize + +candidate3_match_calcBlockSize: + ADDL $0x02, CX + JMP candidate_match_calcBlockSize + +candidate2_match_calcBlockSize: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_calcBlockSize: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_calcBlockSize + +match_extend_back_loop_calcBlockSize: + CMPL CX, SI + JLE match_extend_back_end_calcBlockSize + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_calcBlockSize + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_calcBlockSize + JMP match_extend_back_loop_calcBlockSize + +match_extend_back_end_calcBlockSize: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 5(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_calcBlockSize + MOVQ $0x00000000, ret+24(FP) + RET + +match_dst_size_check_calcBlockSize: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_calcBlockSize + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), SI + CMPL SI, $0x3c + JLT one_byte_match_emit_calcBlockSize + CMPL SI, $0x00000100 + JLT two_bytes_match_emit_calcBlockSize + CMPL SI, $0x00010000 + JLT three_bytes_match_emit_calcBlockSize + CMPL SI, $0x01000000 + JLT four_bytes_match_emit_calcBlockSize + ADDQ $0x05, AX + JMP memmove_long_match_emit_calcBlockSize + +four_bytes_match_emit_calcBlockSize: + ADDQ $0x04, AX + JMP memmove_long_match_emit_calcBlockSize + +three_bytes_match_emit_calcBlockSize: + ADDQ $0x03, AX + JMP memmove_long_match_emit_calcBlockSize + +two_bytes_match_emit_calcBlockSize: + ADDQ $0x02, AX + CMPL SI, $0x40 + JL memmove_match_emit_calcBlockSize + JMP memmove_long_match_emit_calcBlockSize + +one_byte_match_emit_calcBlockSize: + ADDQ $0x01, AX + +memmove_match_emit_calcBlockSize: + LEAQ (AX)(R8*1), AX + JMP emit_literal_done_match_emit_calcBlockSize + +memmove_long_match_emit_calcBlockSize: + LEAQ (AX)(R8*1), AX + +emit_literal_done_match_emit_calcBlockSize: +match_nolit_loop_calcBlockSize: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+8(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_calcBlockSize + +matchlen_loopback_match_nolit_calcBlockSize: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_calcBlockSize + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_calcBlockSize + +matchlen_loop_match_nolit_calcBlockSize: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 + JGE matchlen_loopback_match_nolit_calcBlockSize + JZ match_nolit_end_calcBlockSize + +matchlen_match4_match_nolit_calcBlockSize: + CMPL SI, $0x04 + JL matchlen_match2_match_nolit_calcBlockSize + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 + JNE matchlen_match2_match_nolit_calcBlockSize + SUBL $0x04, SI + LEAL 4(R9), R9 + +matchlen_match2_match_nolit_calcBlockSize: + CMPL SI, $0x02 + JL matchlen_match1_match_nolit_calcBlockSize + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 + JNE matchlen_match1_match_nolit_calcBlockSize + SUBL $0x02, SI + LEAL 2(R9), R9 + +matchlen_match1_match_nolit_calcBlockSize: + CMPL SI, $0x01 + JL match_nolit_end_calcBlockSize + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 + JNE match_nolit_end_calcBlockSize + LEAL 1(R9), R9 + +match_nolit_end_calcBlockSize: + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 + MOVL CX, 12(SP) + + // emitCopy + CMPL BX, $0x00010000 + JL two_byte_offset_match_nolit_calcBlockSize + +four_bytes_loop_back_match_nolit_calcBlockSize: + CMPL R9, $0x40 + JLE four_bytes_remain_match_nolit_calcBlockSize + LEAL -64(R9), R9 + ADDQ $0x05, AX + CMPL R9, $0x04 + JL four_bytes_remain_match_nolit_calcBlockSize + JMP four_bytes_loop_back_match_nolit_calcBlockSize + +four_bytes_remain_match_nolit_calcBlockSize: + TESTL R9, R9 + JZ match_nolit_emitcopy_end_calcBlockSize + XORL BX, BX + ADDQ $0x05, AX + JMP match_nolit_emitcopy_end_calcBlockSize + +two_byte_offset_match_nolit_calcBlockSize: + CMPL R9, $0x40 + JLE two_byte_offset_short_match_nolit_calcBlockSize + LEAL -60(R9), R9 + ADDQ $0x03, AX + JMP two_byte_offset_match_nolit_calcBlockSize + +two_byte_offset_short_match_nolit_calcBlockSize: + MOVL R9, SI + SHLL $0x02, SI + CMPL R9, $0x0c + JGE emit_copy_three_match_nolit_calcBlockSize + CMPL BX, $0x00000800 + JGE emit_copy_three_match_nolit_calcBlockSize + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_calcBlockSize + +emit_copy_three_match_nolit_calcBlockSize: + ADDQ $0x03, AX + +match_nolit_emitcopy_end_calcBlockSize: + CMPL CX, 8(SP) + JGE emit_remainder_calcBlockSize + MOVQ -2(DX)(CX*1), SI + CMPQ AX, (SP) + JL match_nolit_dst_ok_calcBlockSize + MOVQ $0x00000000, ret+24(FP) + RET + +match_nolit_dst_ok_calcBlockSize: + MOVQ $0x0000cf1bbcdcbf9b, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x10, DI + IMULQ R8, DI + SHRQ $0x33, DI + SHLQ $0x10, BX + IMULQ R8, BX + SHRQ $0x33, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI + JEQ match_nolit_loop_calcBlockSize + INCL CX + JMP search_loop_calcBlockSize + +emit_remainder_calcBlockSize: + MOVQ src_len+8(FP), CX + SUBL 12(SP), CX + LEAQ 5(AX)(CX*1), CX + CMPQ CX, (SP) + JL emit_remainder_ok_calcBlockSize + MOVQ $0x00000000, ret+24(FP) + RET + +emit_remainder_ok_calcBlockSize: + MOVQ src_len+8(FP), CX + MOVL 12(SP), BX + CMPL BX, CX + JEQ emit_literal_done_emit_remainder_calcBlockSize + MOVL CX, SI + MOVL CX, 12(SP) + LEAQ (DX)(BX*1), CX + SUBL BX, SI + LEAL -1(SI), CX + CMPL CX, $0x3c + JLT one_byte_emit_remainder_calcBlockSize + CMPL CX, $0x00000100 + JLT two_bytes_emit_remainder_calcBlockSize + CMPL CX, $0x00010000 + JLT three_bytes_emit_remainder_calcBlockSize + CMPL CX, $0x01000000 + JLT four_bytes_emit_remainder_calcBlockSize + ADDQ $0x05, AX + JMP memmove_long_emit_remainder_calcBlockSize + +four_bytes_emit_remainder_calcBlockSize: + ADDQ $0x04, AX + JMP memmove_long_emit_remainder_calcBlockSize + +three_bytes_emit_remainder_calcBlockSize: + ADDQ $0x03, AX + JMP memmove_long_emit_remainder_calcBlockSize + +two_bytes_emit_remainder_calcBlockSize: + ADDQ $0x02, AX + CMPL CX, $0x40 + JL memmove_emit_remainder_calcBlockSize + JMP memmove_long_emit_remainder_calcBlockSize + +one_byte_emit_remainder_calcBlockSize: + ADDQ $0x01, AX + +memmove_emit_remainder_calcBlockSize: + LEAQ (AX)(SI*1), AX + JMP emit_literal_done_emit_remainder_calcBlockSize + +memmove_long_emit_remainder_calcBlockSize: + LEAQ (AX)(SI*1), AX + +emit_literal_done_emit_remainder_calcBlockSize: + MOVQ AX, ret+24(FP) + RET + +// func calcBlockSizeSmall(src []byte) int +// Requires: BMI, SSE2 +TEXT ·calcBlockSizeSmall(SB), $2072-32 + XORQ AX, AX + MOVQ $0x00000010, CX + LEAQ 24(SP), DX + PXOR X0, X0 + +zero_loop_calcBlockSizeSmall: + MOVOU X0, (DX) + MOVOU X0, 16(DX) + MOVOU X0, 32(DX) + MOVOU X0, 48(DX) + MOVOU X0, 64(DX) + MOVOU X0, 80(DX) + MOVOU X0, 96(DX) + MOVOU X0, 112(DX) + ADDQ $0x80, DX + DECQ CX + JNZ zero_loop_calcBlockSizeSmall + MOVL $0x00000000, 12(SP) + MOVQ src_len+8(FP), CX + LEAQ -9(CX), DX + LEAQ -8(CX), BX + MOVL BX, 8(SP) + SHRQ $0x05, CX + SUBL CX, DX + LEAQ (AX)(DX*1), DX + MOVQ DX, (SP) + MOVL $0x00000001, CX + MOVL CX, 16(SP) + MOVQ src_base+0(FP), DX + +search_loop_calcBlockSizeSmall: + MOVL CX, BX + SUBL 12(SP), BX + SHRL $0x04, BX + LEAL 4(CX)(BX*1), BX + CMPL BX, 8(SP) + JGE emit_remainder_calcBlockSizeSmall + MOVQ (DX)(CX*1), SI + MOVL BX, 20(SP) + MOVQ $0x9e3779b1, R8 + MOVQ SI, R9 + MOVQ SI, R10 + SHRQ $0x08, R10 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x37, R9 + SHLQ $0x20, R10 + IMULQ R8, R10 + SHRQ $0x37, R10 + MOVL 24(SP)(R9*4), BX + MOVL 24(SP)(R10*4), DI + MOVL CX, 24(SP)(R9*4) + LEAL 1(CX), R9 + MOVL R9, 24(SP)(R10*4) + MOVQ SI, R9 + SHRQ $0x10, R9 + SHLQ $0x20, R9 + IMULQ R8, R9 + SHRQ $0x37, R9 + MOVL CX, R8 + SUBL 16(SP), R8 + MOVL 1(DX)(R8*1), R10 + MOVQ SI, R8 + SHRQ $0x08, R8 + CMPL R8, R10 + JNE no_repeat_found_calcBlockSizeSmall + LEAL 1(CX), SI + MOVL 12(SP), BX + MOVL SI, DI + SUBL 16(SP), DI + JZ repeat_extend_back_end_calcBlockSizeSmall + +repeat_extend_back_loop_calcBlockSizeSmall: + CMPL SI, BX + JLE repeat_extend_back_end_calcBlockSizeSmall + MOVB -1(DX)(DI*1), R8 + MOVB -1(DX)(SI*1), R9 + CMPB R8, R9 + JNE repeat_extend_back_end_calcBlockSizeSmall + LEAL -1(SI), SI + DECL DI + JNZ repeat_extend_back_loop_calcBlockSizeSmall + +repeat_extend_back_end_calcBlockSizeSmall: + MOVL 12(SP), BX + CMPL BX, SI + JEQ emit_literal_done_repeat_emit_calcBlockSizeSmall + MOVL SI, DI + MOVL SI, 12(SP) + LEAQ (DX)(BX*1), R8 + SUBL BX, DI + LEAL -1(DI), BX + CMPL BX, $0x3c + JLT one_byte_repeat_emit_calcBlockSizeSmall + CMPL BX, $0x00000100 + JLT two_bytes_repeat_emit_calcBlockSizeSmall + ADDQ $0x03, AX + JMP memmove_long_repeat_emit_calcBlockSizeSmall + +two_bytes_repeat_emit_calcBlockSizeSmall: + ADDQ $0x02, AX + CMPL BX, $0x40 + JL memmove_repeat_emit_calcBlockSizeSmall + JMP memmove_long_repeat_emit_calcBlockSizeSmall + +one_byte_repeat_emit_calcBlockSizeSmall: + ADDQ $0x01, AX + +memmove_repeat_emit_calcBlockSizeSmall: + LEAQ (AX)(DI*1), AX + JMP emit_literal_done_repeat_emit_calcBlockSizeSmall + +memmove_long_repeat_emit_calcBlockSizeSmall: + LEAQ (AX)(DI*1), AX + +emit_literal_done_repeat_emit_calcBlockSizeSmall: + ADDL $0x05, CX + MOVL CX, BX + SUBL 16(SP), BX + MOVQ src_len+8(FP), DI + SUBL CX, DI + LEAQ (DX)(CX*1), R8 + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R10, R10 + CMPL DI, $0x08 + JL matchlen_match4_repeat_extend_calcBlockSizeSmall + +matchlen_loopback_repeat_extend_calcBlockSizeSmall: + MOVQ (R8)(R10*1), R9 + XORQ (BX)(R10*1), R9 + TESTQ R9, R9 + JZ matchlen_loop_repeat_extend_calcBlockSizeSmall + +#ifdef GOAMD64_v3 + TZCNTQ R9, R9 + +#else + BSFQ R9, R9 + +#endif + SARQ $0x03, R9 + LEAL (R10)(R9*1), R10 + JMP repeat_extend_forward_end_calcBlockSizeSmall + +matchlen_loop_repeat_extend_calcBlockSizeSmall: + LEAL -8(DI), DI + LEAL 8(R10), R10 + CMPL DI, $0x08 + JGE matchlen_loopback_repeat_extend_calcBlockSizeSmall + JZ repeat_extend_forward_end_calcBlockSizeSmall + +matchlen_match4_repeat_extend_calcBlockSizeSmall: + CMPL DI, $0x04 + JL matchlen_match2_repeat_extend_calcBlockSizeSmall + MOVL (R8)(R10*1), R9 + CMPL (BX)(R10*1), R9 + JNE matchlen_match2_repeat_extend_calcBlockSizeSmall + SUBL $0x04, DI + LEAL 4(R10), R10 + +matchlen_match2_repeat_extend_calcBlockSizeSmall: + CMPL DI, $0x02 + JL matchlen_match1_repeat_extend_calcBlockSizeSmall + MOVW (R8)(R10*1), R9 + CMPW (BX)(R10*1), R9 + JNE matchlen_match1_repeat_extend_calcBlockSizeSmall + SUBL $0x02, DI + LEAL 2(R10), R10 + +matchlen_match1_repeat_extend_calcBlockSizeSmall: + CMPL DI, $0x01 + JL repeat_extend_forward_end_calcBlockSizeSmall + MOVB (R8)(R10*1), R9 + CMPB (BX)(R10*1), R9 + JNE repeat_extend_forward_end_calcBlockSizeSmall + LEAL 1(R10), R10 + +repeat_extend_forward_end_calcBlockSizeSmall: + ADDL R10, CX + MOVL CX, BX + SUBL SI, BX + MOVL 16(SP), SI + + // emitCopy +two_byte_offset_repeat_as_copy_calcBlockSizeSmall: + CMPL BX, $0x40 + JLE two_byte_offset_short_repeat_as_copy_calcBlockSizeSmall + LEAL -60(BX), BX + ADDQ $0x03, AX + JMP two_byte_offset_repeat_as_copy_calcBlockSizeSmall + +two_byte_offset_short_repeat_as_copy_calcBlockSizeSmall: + MOVL BX, SI + SHLL $0x02, SI + CMPL BX, $0x0c + JGE emit_copy_three_repeat_as_copy_calcBlockSizeSmall + ADDQ $0x02, AX + JMP repeat_end_emit_calcBlockSizeSmall + +emit_copy_three_repeat_as_copy_calcBlockSizeSmall: + ADDQ $0x03, AX + +repeat_end_emit_calcBlockSizeSmall: + MOVL CX, 12(SP) + JMP search_loop_calcBlockSizeSmall + +no_repeat_found_calcBlockSizeSmall: + CMPL (DX)(BX*1), SI + JEQ candidate_match_calcBlockSizeSmall + SHRQ $0x08, SI + MOVL 24(SP)(R9*4), BX + LEAL 2(CX), R8 + CMPL (DX)(DI*1), SI + JEQ candidate2_match_calcBlockSizeSmall + MOVL R8, 24(SP)(R9*4) + SHRQ $0x08, SI + CMPL (DX)(BX*1), SI + JEQ candidate3_match_calcBlockSizeSmall + MOVL 20(SP), CX + JMP search_loop_calcBlockSizeSmall + +candidate3_match_calcBlockSizeSmall: + ADDL $0x02, CX + JMP candidate_match_calcBlockSizeSmall + +candidate2_match_calcBlockSizeSmall: + MOVL R8, 24(SP)(R9*4) + INCL CX + MOVL DI, BX + +candidate_match_calcBlockSizeSmall: + MOVL 12(SP), SI + TESTL BX, BX + JZ match_extend_back_end_calcBlockSizeSmall + +match_extend_back_loop_calcBlockSizeSmall: + CMPL CX, SI + JLE match_extend_back_end_calcBlockSizeSmall + MOVB -1(DX)(BX*1), DI + MOVB -1(DX)(CX*1), R8 + CMPB DI, R8 + JNE match_extend_back_end_calcBlockSizeSmall + LEAL -1(CX), CX + DECL BX + JZ match_extend_back_end_calcBlockSizeSmall + JMP match_extend_back_loop_calcBlockSizeSmall + +match_extend_back_end_calcBlockSizeSmall: + MOVL CX, SI + SUBL 12(SP), SI + LEAQ 3(AX)(SI*1), SI + CMPQ SI, (SP) + JL match_dst_size_check_calcBlockSizeSmall + MOVQ $0x00000000, ret+24(FP) + RET + +match_dst_size_check_calcBlockSizeSmall: + MOVL CX, SI + MOVL 12(SP), DI + CMPL DI, SI + JEQ emit_literal_done_match_emit_calcBlockSizeSmall + MOVL SI, R8 + MOVL SI, 12(SP) + LEAQ (DX)(DI*1), SI + SUBL DI, R8 + LEAL -1(R8), SI + CMPL SI, $0x3c + JLT one_byte_match_emit_calcBlockSizeSmall + CMPL SI, $0x00000100 + JLT two_bytes_match_emit_calcBlockSizeSmall + ADDQ $0x03, AX + JMP memmove_long_match_emit_calcBlockSizeSmall + +two_bytes_match_emit_calcBlockSizeSmall: + ADDQ $0x02, AX + CMPL SI, $0x40 + JL memmove_match_emit_calcBlockSizeSmall + JMP memmove_long_match_emit_calcBlockSizeSmall + +one_byte_match_emit_calcBlockSizeSmall: + ADDQ $0x01, AX + +memmove_match_emit_calcBlockSizeSmall: + LEAQ (AX)(R8*1), AX + JMP emit_literal_done_match_emit_calcBlockSizeSmall + +memmove_long_match_emit_calcBlockSizeSmall: + LEAQ (AX)(R8*1), AX + +emit_literal_done_match_emit_calcBlockSizeSmall: +match_nolit_loop_calcBlockSizeSmall: + MOVL CX, SI + SUBL BX, SI + MOVL SI, 16(SP) + ADDL $0x04, CX + ADDL $0x04, BX + MOVQ src_len+8(FP), SI + SUBL CX, SI + LEAQ (DX)(CX*1), DI + LEAQ (DX)(BX*1), BX + + // matchLen + XORL R9, R9 + CMPL SI, $0x08 + JL matchlen_match4_match_nolit_calcBlockSizeSmall + +matchlen_loopback_match_nolit_calcBlockSizeSmall: + MOVQ (DI)(R9*1), R8 + XORQ (BX)(R9*1), R8 + TESTQ R8, R8 + JZ matchlen_loop_match_nolit_calcBlockSizeSmall + +#ifdef GOAMD64_v3 + TZCNTQ R8, R8 + +#else + BSFQ R8, R8 + +#endif + SARQ $0x03, R8 + LEAL (R9)(R8*1), R9 + JMP match_nolit_end_calcBlockSizeSmall + +matchlen_loop_match_nolit_calcBlockSizeSmall: + LEAL -8(SI), SI + LEAL 8(R9), R9 + CMPL SI, $0x08 + JGE matchlen_loopback_match_nolit_calcBlockSizeSmall + JZ match_nolit_end_calcBlockSizeSmall + +matchlen_match4_match_nolit_calcBlockSizeSmall: + CMPL SI, $0x04 + JL matchlen_match2_match_nolit_calcBlockSizeSmall + MOVL (DI)(R9*1), R8 + CMPL (BX)(R9*1), R8 + JNE matchlen_match2_match_nolit_calcBlockSizeSmall + SUBL $0x04, SI + LEAL 4(R9), R9 + +matchlen_match2_match_nolit_calcBlockSizeSmall: + CMPL SI, $0x02 + JL matchlen_match1_match_nolit_calcBlockSizeSmall + MOVW (DI)(R9*1), R8 + CMPW (BX)(R9*1), R8 + JNE matchlen_match1_match_nolit_calcBlockSizeSmall + SUBL $0x02, SI + LEAL 2(R9), R9 + +matchlen_match1_match_nolit_calcBlockSizeSmall: + CMPL SI, $0x01 + JL match_nolit_end_calcBlockSizeSmall + MOVB (DI)(R9*1), R8 + CMPB (BX)(R9*1), R8 + JNE match_nolit_end_calcBlockSizeSmall + LEAL 1(R9), R9 + +match_nolit_end_calcBlockSizeSmall: + ADDL R9, CX + MOVL 16(SP), BX + ADDL $0x04, R9 + MOVL CX, 12(SP) + + // emitCopy +two_byte_offset_match_nolit_calcBlockSizeSmall: + CMPL R9, $0x40 + JLE two_byte_offset_short_match_nolit_calcBlockSizeSmall + LEAL -60(R9), R9 + ADDQ $0x03, AX + JMP two_byte_offset_match_nolit_calcBlockSizeSmall + +two_byte_offset_short_match_nolit_calcBlockSizeSmall: + MOVL R9, BX + SHLL $0x02, BX + CMPL R9, $0x0c + JGE emit_copy_three_match_nolit_calcBlockSizeSmall + ADDQ $0x02, AX + JMP match_nolit_emitcopy_end_calcBlockSizeSmall + +emit_copy_three_match_nolit_calcBlockSizeSmall: + ADDQ $0x03, AX + +match_nolit_emitcopy_end_calcBlockSizeSmall: + CMPL CX, 8(SP) + JGE emit_remainder_calcBlockSizeSmall + MOVQ -2(DX)(CX*1), SI + CMPQ AX, (SP) + JL match_nolit_dst_ok_calcBlockSizeSmall + MOVQ $0x00000000, ret+24(FP) + RET + +match_nolit_dst_ok_calcBlockSizeSmall: + MOVQ $0x9e3779b1, R8 + MOVQ SI, DI + SHRQ $0x10, SI + MOVQ SI, BX + SHLQ $0x20, DI + IMULQ R8, DI + SHRQ $0x37, DI + SHLQ $0x20, BX + IMULQ R8, BX + SHRQ $0x37, BX + LEAL -2(CX), R8 + LEAQ 24(SP)(BX*4), R9 + MOVL (R9), BX + MOVL R8, 24(SP)(DI*4) + MOVL CX, (R9) + CMPL (DX)(BX*1), SI + JEQ match_nolit_loop_calcBlockSizeSmall + INCL CX + JMP search_loop_calcBlockSizeSmall + +emit_remainder_calcBlockSizeSmall: + MOVQ src_len+8(FP), CX + SUBL 12(SP), CX + LEAQ 3(AX)(CX*1), CX + CMPQ CX, (SP) + JL emit_remainder_ok_calcBlockSizeSmall + MOVQ $0x00000000, ret+24(FP) + RET + +emit_remainder_ok_calcBlockSizeSmall: + MOVQ src_len+8(FP), CX + MOVL 12(SP), BX + CMPL BX, CX + JEQ emit_literal_done_emit_remainder_calcBlockSizeSmall + MOVL CX, SI + MOVL CX, 12(SP) + LEAQ (DX)(BX*1), CX + SUBL BX, SI + LEAL -1(SI), CX + CMPL CX, $0x3c + JLT one_byte_emit_remainder_calcBlockSizeSmall + CMPL CX, $0x00000100 + JLT two_bytes_emit_remainder_calcBlockSizeSmall + ADDQ $0x03, AX + JMP memmove_long_emit_remainder_calcBlockSizeSmall + +two_bytes_emit_remainder_calcBlockSizeSmall: + ADDQ $0x02, AX + CMPL CX, $0x40 + JL memmove_emit_remainder_calcBlockSizeSmall + JMP memmove_long_emit_remainder_calcBlockSizeSmall + +one_byte_emit_remainder_calcBlockSizeSmall: + ADDQ $0x01, AX + +memmove_emit_remainder_calcBlockSizeSmall: + LEAQ (AX)(SI*1), AX + JMP emit_literal_done_emit_remainder_calcBlockSizeSmall + +memmove_long_emit_remainder_calcBlockSizeSmall: + LEAQ (AX)(SI*1), AX + +emit_literal_done_emit_remainder_calcBlockSizeSmall: + MOVQ AX, ret+24(FP) + RET + // func emitLiteral(dst []byte, lit []byte) int // Requires: SSE2 TEXT ·emitLiteral(SB), NOSPLIT, $0-56 @@ -17274,8 +18292,7 @@ cant_repeat_two_offset_standalone: CMPL DX, $0x0100ffff JLT repeat_five_standalone LEAL -16842747(DX), DX - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX ADDQ $0x05, BX @@ -17341,8 +18358,6 @@ TEXT ·emitCopy(SB), NOSPLIT, $0-48 // emitCopy CMPL CX, $0x00010000 JL two_byte_offset_standalone - -four_bytes_loop_back_standalone: CMPL DX, $0x40 JLE four_bytes_remain_standalone MOVB $0xff, (AX) @@ -17372,8 +18387,7 @@ cant_repeat_two_offset_standalone_emit_copy: CMPL DX, $0x0100ffff JLT repeat_five_standalone_emit_copy LEAL -16842747(DX), DX - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX ADDQ $0x05, BX @@ -17425,13 +18439,12 @@ repeat_two_offset_standalone_emit_copy: ADDQ $0x02, BX ADDQ $0x02, AX JMP gen_emit_copy_end - JMP four_bytes_loop_back_standalone four_bytes_remain_standalone: TESTL DX, DX JZ gen_emit_copy_end - MOVB $0x03, SI - LEAL -4(SI)(DX*4), DX + XORL SI, SI + LEAL -1(SI)(DX*4), DX MOVB DL, (AX) MOVL CX, 1(AX) ADDQ $0x05, BX @@ -17477,8 +18490,7 @@ cant_repeat_two_offset_standalone_emit_copy_short_2b: CMPL DX, $0x0100ffff JLT repeat_five_standalone_emit_copy_short_2b LEAL -16842747(DX), DX - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX ADDQ $0x05, BX @@ -17557,8 +18569,7 @@ cant_repeat_two_offset_standalone_emit_copy_short: CMPL DX, $0x0100ffff JLT repeat_five_standalone_emit_copy_short LEAL -16842747(DX), DX - MOVW $0x001d, (AX) - MOVW $0xfffb, 2(AX) + MOVL $0xfffb001d, (AX) MOVB $0xff, 4(AX) ADDQ $0x05, AX ADDQ $0x05, BX @@ -17610,28 +18621,27 @@ repeat_two_offset_standalone_emit_copy_short: ADDQ $0x02, BX ADDQ $0x02, AX JMP gen_emit_copy_end - JMP two_byte_offset_standalone two_byte_offset_short_standalone: + MOVL DX, SI + SHLL $0x02, SI CMPL DX, $0x0c JGE emit_copy_three_standalone CMPL CX, $0x00000800 JGE emit_copy_three_standalone - MOVB $0x01, SI - LEAL -16(SI)(DX*4), DX + LEAL -15(SI), SI MOVB CL, 1(AX) SHRL $0x08, CX SHLL $0x05, CX - ORL CX, DX - MOVB DL, (AX) + ORL CX, SI + MOVB SI, (AX) ADDQ $0x02, BX ADDQ $0x02, AX JMP gen_emit_copy_end emit_copy_three_standalone: - MOVB $0x02, SI - LEAL -4(SI)(DX*4), DX - MOVB DL, (AX) + LEAL -2(SI), SI + MOVB SI, (AX) MOVW CX, 1(AX) ADDQ $0x03, BX ADDQ $0x03, AX @@ -17666,8 +18676,8 @@ four_bytes_loop_back_standalone_snappy: four_bytes_remain_standalone_snappy: TESTL DX, DX JZ gen_emit_copy_end_snappy - MOVB $0x03, SI - LEAL -4(SI)(DX*4), DX + XORL SI, SI + LEAL -1(SI)(DX*4), DX MOVB DL, (AX) MOVL CX, 1(AX) ADDQ $0x05, BX @@ -17685,25 +18695,25 @@ two_byte_offset_standalone_snappy: JMP two_byte_offset_standalone_snappy two_byte_offset_short_standalone_snappy: + MOVL DX, SI + SHLL $0x02, SI CMPL DX, $0x0c JGE emit_copy_three_standalone_snappy CMPL CX, $0x00000800 JGE emit_copy_three_standalone_snappy - MOVB $0x01, SI - LEAL -16(SI)(DX*4), DX + LEAL -15(SI), SI MOVB CL, 1(AX) SHRL $0x08, CX SHLL $0x05, CX - ORL CX, DX - MOVB DL, (AX) + ORL CX, SI + MOVB SI, (AX) ADDQ $0x02, BX ADDQ $0x02, AX JMP gen_emit_copy_end_snappy emit_copy_three_standalone_snappy: - MOVB $0x02, SI - LEAL -4(SI)(DX*4), DX - MOVB DL, (AX) + LEAL -2(SI), SI + MOVB SI, (AX) MOVW CX, 1(AX) ADDQ $0x03, BX ADDQ $0x03, AX @@ -17777,3 +18787,752 @@ matchlen_match1_standalone: gen_match_len_end: MOVQ SI, ret+48(FP) RET + +// func cvtLZ4BlockAsm(dst []byte, src []byte) (uncompressed int, dstUsed int) +// Requires: SSE2 +TEXT ·cvtLZ4BlockAsm(SB), NOSPLIT, $0-64 + XORQ SI, SI + MOVQ dst_base+0(FP), AX + MOVQ dst_len+8(FP), CX + MOVQ src_base+24(FP), DX + MOVQ src_len+32(FP), BX + LEAQ (DX)(BX*1), BX + LEAQ -10(AX)(CX*1), CX + XORQ DI, DI + +lz4_s2_loop: + CMPQ DX, BX + JAE lz4_s2_corrupt + CMPQ AX, CX + JAE lz4_s2_dstfull + MOVBQZX (DX), R8 + MOVQ R8, R9 + MOVQ R8, R10 + SHRQ $0x04, R9 + ANDQ $0x0f, R10 + CMPQ R8, $0xf0 + JB lz4_s2_ll_end + +lz4_s2_ll_loop: + INCQ DX + CMPQ DX, BX + JAE lz4_s2_corrupt + MOVBQZX (DX), R8 + ADDQ R8, R9 + CMPQ R8, $0xff + JEQ lz4_s2_ll_loop + +lz4_s2_ll_end: + LEAQ (DX)(R9*1), R8 + ADDQ $0x04, R10 + CMPQ R8, BX + JAE lz4_s2_corrupt + INCQ DX + INCQ R8 + TESTQ R9, R9 + JZ lz4_s2_lits_done + LEAQ (AX)(R9*1), R11 + CMPQ R11, CX + JAE lz4_s2_dstfull + ADDQ R9, SI + LEAL -1(R9), R11 + CMPL R11, $0x3c + JLT one_byte_lz4_s2 + CMPL R11, $0x00000100 + JLT two_bytes_lz4_s2 + CMPL R11, $0x00010000 + JLT three_bytes_lz4_s2 + CMPL R11, $0x01000000 + JLT four_bytes_lz4_s2 + MOVB $0xfc, (AX) + MOVL R11, 1(AX) + ADDQ $0x05, AX + JMP memmove_long_lz4_s2 + +four_bytes_lz4_s2: + MOVL R11, R12 + SHRL $0x10, R12 + MOVB $0xf8, (AX) + MOVW R11, 1(AX) + MOVB R12, 3(AX) + ADDQ $0x04, AX + JMP memmove_long_lz4_s2 + +three_bytes_lz4_s2: + MOVB $0xf4, (AX) + MOVW R11, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_lz4_s2 + +two_bytes_lz4_s2: + MOVB $0xf0, (AX) + MOVB R11, 1(AX) + ADDQ $0x02, AX + CMPL R11, $0x40 + JL memmove_lz4_s2 + JMP memmove_long_lz4_s2 + +one_byte_lz4_s2: + SHLB $0x02, R11 + MOVB R11, (AX) + ADDQ $0x01, AX + +memmove_lz4_s2: + LEAQ (AX)(R9*1), R11 + + // genMemMoveShort + CMPQ R9, $0x08 + JLE emit_lit_memmove_lz4_s2_memmove_move_8 + CMPQ R9, $0x10 + JBE emit_lit_memmove_lz4_s2_memmove_move_8through16 + CMPQ R9, $0x20 + JBE emit_lit_memmove_lz4_s2_memmove_move_17through32 + JMP emit_lit_memmove_lz4_s2_memmove_move_33through64 + +emit_lit_memmove_lz4_s2_memmove_move_8: + MOVQ (DX), R12 + MOVQ R12, (AX) + JMP memmove_end_copy_lz4_s2 + +emit_lit_memmove_lz4_s2_memmove_move_8through16: + MOVQ (DX), R12 + MOVQ -8(DX)(R9*1), DX + MOVQ R12, (AX) + MOVQ DX, -8(AX)(R9*1) + JMP memmove_end_copy_lz4_s2 + +emit_lit_memmove_lz4_s2_memmove_move_17through32: + MOVOU (DX), X0 + MOVOU -16(DX)(R9*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R9*1) + JMP memmove_end_copy_lz4_s2 + +emit_lit_memmove_lz4_s2_memmove_move_33through64: + MOVOU (DX), X0 + MOVOU 16(DX), X1 + MOVOU -32(DX)(R9*1), X2 + MOVOU -16(DX)(R9*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R9*1) + MOVOU X3, -16(AX)(R9*1) + +memmove_end_copy_lz4_s2: + MOVQ R11, AX + JMP lz4_s2_lits_emit_done + +memmove_long_lz4_s2: + LEAQ (AX)(R9*1), R11 + + // genMemMoveLong + MOVOU (DX), X0 + MOVOU 16(DX), X1 + MOVOU -32(DX)(R9*1), X2 + MOVOU -16(DX)(R9*1), X3 + MOVQ R9, R13 + SHRQ $0x05, R13 + MOVQ AX, R12 + ANDL $0x0000001f, R12 + MOVQ $0x00000040, R14 + SUBQ R12, R14 + DECQ R13 + JA emit_lit_memmove_long_lz4_s2large_forward_sse_loop_32 + LEAQ -32(DX)(R14*1), R12 + LEAQ -32(AX)(R14*1), R15 + +emit_lit_memmove_long_lz4_s2large_big_loop_back: + MOVOU (R12), X4 + MOVOU 16(R12), X5 + MOVOA X4, (R15) + MOVOA X5, 16(R15) + ADDQ $0x20, R15 + ADDQ $0x20, R12 + ADDQ $0x20, R14 + DECQ R13 + JNA emit_lit_memmove_long_lz4_s2large_big_loop_back + +emit_lit_memmove_long_lz4_s2large_forward_sse_loop_32: + MOVOU -32(DX)(R14*1), X4 + MOVOU -16(DX)(R14*1), X5 + MOVOA X4, -32(AX)(R14*1) + MOVOA X5, -16(AX)(R14*1) + ADDQ $0x20, R14 + CMPQ R9, R14 + JAE emit_lit_memmove_long_lz4_s2large_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R9*1) + MOVOU X3, -16(AX)(R9*1) + MOVQ R11, AX + +lz4_s2_lits_emit_done: + MOVQ R8, DX + +lz4_s2_lits_done: + CMPQ DX, BX + JNE lz4_s2_match + CMPQ R10, $0x04 + JEQ lz4_s2_done + JMP lz4_s2_corrupt + +lz4_s2_match: + LEAQ 2(DX), R8 + CMPQ R8, BX + JAE lz4_s2_corrupt + MOVWQZX (DX), R9 + MOVQ R8, DX + TESTQ R9, R9 + JZ lz4_s2_corrupt + CMPQ R9, SI + JA lz4_s2_corrupt + CMPQ R10, $0x13 + JNE lz4_s2_ml_done + +lz4_s2_ml_loop: + MOVBQZX (DX), R8 + INCQ DX + ADDQ R8, R10 + CMPQ DX, BX + JAE lz4_s2_corrupt + CMPQ R8, $0xff + JEQ lz4_s2_ml_loop + +lz4_s2_ml_done: + ADDQ R10, SI + CMPQ R9, DI + JNE lz4_s2_docopy + + // emitRepeat +emit_repeat_again_lz4_s2: + MOVL R10, R8 + LEAL -4(R10), R10 + CMPL R8, $0x08 + JLE repeat_two_lz4_s2 + CMPL R8, $0x0c + JGE cant_repeat_two_offset_lz4_s2 + CMPL R9, $0x00000800 + JLT repeat_two_offset_lz4_s2 + +cant_repeat_two_offset_lz4_s2: + CMPL R10, $0x00000104 + JLT repeat_three_lz4_s2 + CMPL R10, $0x00010100 + JLT repeat_four_lz4_s2 + CMPL R10, $0x0100ffff + JLT repeat_five_lz4_s2 + LEAL -16842747(R10), R10 + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_lz4_s2 + +repeat_five_lz4_s2: + LEAL -65536(R10), R10 + MOVL R10, R9 + MOVW $0x001d, (AX) + MOVW R10, 2(AX) + SARL $0x10, R9 + MOVB R9, 4(AX) + ADDQ $0x05, AX + JMP lz4_s2_loop + +repeat_four_lz4_s2: + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP lz4_s2_loop + +repeat_three_lz4_s2: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP lz4_s2_loop + +repeat_two_lz4_s2: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +repeat_two_offset_lz4_s2: + XORQ R8, R8 + LEAL 1(R8)(R10*4), R10 + MOVB R9, 1(AX) + SARL $0x08, R9 + SHLL $0x05, R9 + ORL R9, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +lz4_s2_docopy: + MOVQ R9, DI + + // emitCopy + CMPL R10, $0x40 + JLE two_byte_offset_short_lz4_s2 + CMPL R9, $0x00000800 + JAE long_offset_short_lz4_s2 + MOVL $0x00000001, R8 + LEAL 16(R8), R8 + MOVB R9, 1(AX) + MOVL R9, R11 + SHRL $0x08, R11 + SHLL $0x05, R11 + ORL R11, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + SUBL $0x08, R10 + + // emitRepeat + LEAL -4(R10), R10 + JMP cant_repeat_two_offset_lz4_s2_emit_copy_short_2b + +emit_repeat_again_lz4_s2_emit_copy_short_2b: + MOVL R10, R8 + LEAL -4(R10), R10 + CMPL R8, $0x08 + JLE repeat_two_lz4_s2_emit_copy_short_2b + CMPL R8, $0x0c + JGE cant_repeat_two_offset_lz4_s2_emit_copy_short_2b + CMPL R9, $0x00000800 + JLT repeat_two_offset_lz4_s2_emit_copy_short_2b + +cant_repeat_two_offset_lz4_s2_emit_copy_short_2b: + CMPL R10, $0x00000104 + JLT repeat_three_lz4_s2_emit_copy_short_2b + CMPL R10, $0x00010100 + JLT repeat_four_lz4_s2_emit_copy_short_2b + CMPL R10, $0x0100ffff + JLT repeat_five_lz4_s2_emit_copy_short_2b + LEAL -16842747(R10), R10 + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_lz4_s2_emit_copy_short_2b + +repeat_five_lz4_s2_emit_copy_short_2b: + LEAL -65536(R10), R10 + MOVL R10, R9 + MOVW $0x001d, (AX) + MOVW R10, 2(AX) + SARL $0x10, R9 + MOVB R9, 4(AX) + ADDQ $0x05, AX + JMP lz4_s2_loop + +repeat_four_lz4_s2_emit_copy_short_2b: + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP lz4_s2_loop + +repeat_three_lz4_s2_emit_copy_short_2b: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP lz4_s2_loop + +repeat_two_lz4_s2_emit_copy_short_2b: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +repeat_two_offset_lz4_s2_emit_copy_short_2b: + XORQ R8, R8 + LEAL 1(R8)(R10*4), R10 + MOVB R9, 1(AX) + SARL $0x08, R9 + SHLL $0x05, R9 + ORL R9, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +long_offset_short_lz4_s2: + MOVB $0xee, (AX) + MOVW R9, 1(AX) + LEAL -60(R10), R10 + ADDQ $0x03, AX + + // emitRepeat +emit_repeat_again_lz4_s2_emit_copy_short: + MOVL R10, R8 + LEAL -4(R10), R10 + CMPL R8, $0x08 + JLE repeat_two_lz4_s2_emit_copy_short + CMPL R8, $0x0c + JGE cant_repeat_two_offset_lz4_s2_emit_copy_short + CMPL R9, $0x00000800 + JLT repeat_two_offset_lz4_s2_emit_copy_short + +cant_repeat_two_offset_lz4_s2_emit_copy_short: + CMPL R10, $0x00000104 + JLT repeat_three_lz4_s2_emit_copy_short + CMPL R10, $0x00010100 + JLT repeat_four_lz4_s2_emit_copy_short + CMPL R10, $0x0100ffff + JLT repeat_five_lz4_s2_emit_copy_short + LEAL -16842747(R10), R10 + MOVL $0xfffb001d, (AX) + MOVB $0xff, 4(AX) + ADDQ $0x05, AX + JMP emit_repeat_again_lz4_s2_emit_copy_short + +repeat_five_lz4_s2_emit_copy_short: + LEAL -65536(R10), R10 + MOVL R10, R9 + MOVW $0x001d, (AX) + MOVW R10, 2(AX) + SARL $0x10, R9 + MOVB R9, 4(AX) + ADDQ $0x05, AX + JMP lz4_s2_loop + +repeat_four_lz4_s2_emit_copy_short: + LEAL -256(R10), R10 + MOVW $0x0019, (AX) + MOVW R10, 2(AX) + ADDQ $0x04, AX + JMP lz4_s2_loop + +repeat_three_lz4_s2_emit_copy_short: + LEAL -4(R10), R10 + MOVW $0x0015, (AX) + MOVB R10, 2(AX) + ADDQ $0x03, AX + JMP lz4_s2_loop + +repeat_two_lz4_s2_emit_copy_short: + SHLL $0x02, R10 + ORL $0x01, R10 + MOVW R10, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +repeat_two_offset_lz4_s2_emit_copy_short: + XORQ R8, R8 + LEAL 1(R8)(R10*4), R10 + MOVB R9, 1(AX) + SARL $0x08, R9 + SHLL $0x05, R9 + ORL R9, R10 + MOVB R10, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +two_byte_offset_short_lz4_s2: + MOVL R10, R8 + SHLL $0x02, R8 + CMPL R10, $0x0c + JGE emit_copy_three_lz4_s2 + CMPL R9, $0x00000800 + JGE emit_copy_three_lz4_s2 + LEAL -15(R8), R8 + MOVB R9, 1(AX) + SHRL $0x08, R9 + SHLL $0x05, R9 + ORL R9, R8 + MOVB R8, (AX) + ADDQ $0x02, AX + JMP lz4_s2_loop + +emit_copy_three_lz4_s2: + LEAL -2(R8), R8 + MOVB R8, (AX) + MOVW R9, 1(AX) + ADDQ $0x03, AX + JMP lz4_s2_loop + +lz4_s2_done: + MOVQ dst_base+0(FP), CX + SUBQ CX, AX + MOVQ SI, uncompressed+48(FP) + MOVQ AX, dstUsed+56(FP) + RET + +lz4_s2_corrupt: + XORQ AX, AX + LEAQ -1(AX), SI + MOVQ SI, uncompressed+48(FP) + RET + +lz4_s2_dstfull: + XORQ AX, AX + LEAQ -2(AX), SI + MOVQ SI, uncompressed+48(FP) + RET + +// func cvtLZ4BlockSnappyAsm(dst []byte, src []byte) (uncompressed int, dstUsed int) +// Requires: SSE2 +TEXT ·cvtLZ4BlockSnappyAsm(SB), NOSPLIT, $0-64 + XORQ SI, SI + MOVQ dst_base+0(FP), AX + MOVQ dst_len+8(FP), CX + MOVQ src_base+24(FP), DX + MOVQ src_len+32(FP), BX + LEAQ (DX)(BX*1), BX + LEAQ -10(AX)(CX*1), CX + +lz4_snappy_loop: + CMPQ DX, BX + JAE lz4_snappy_corrupt + CMPQ AX, CX + JAE lz4_snappy_dstfull + MOVBQZX (DX), DI + MOVQ DI, R8 + MOVQ DI, R9 + SHRQ $0x04, R8 + ANDQ $0x0f, R9 + CMPQ DI, $0xf0 + JB lz4_snappy_ll_end + +lz4_snappy_ll_loop: + INCQ DX + CMPQ DX, BX + JAE lz4_snappy_corrupt + MOVBQZX (DX), DI + ADDQ DI, R8 + CMPQ DI, $0xff + JEQ lz4_snappy_ll_loop + +lz4_snappy_ll_end: + LEAQ (DX)(R8*1), DI + ADDQ $0x04, R9 + CMPQ DI, BX + JAE lz4_snappy_corrupt + INCQ DX + INCQ DI + TESTQ R8, R8 + JZ lz4_snappy_lits_done + LEAQ (AX)(R8*1), R10 + CMPQ R10, CX + JAE lz4_snappy_dstfull + ADDQ R8, SI + LEAL -1(R8), R10 + CMPL R10, $0x3c + JLT one_byte_lz4_snappy + CMPL R10, $0x00000100 + JLT two_bytes_lz4_snappy + CMPL R10, $0x00010000 + JLT three_bytes_lz4_snappy + CMPL R10, $0x01000000 + JLT four_bytes_lz4_snappy + MOVB $0xfc, (AX) + MOVL R10, 1(AX) + ADDQ $0x05, AX + JMP memmove_long_lz4_snappy + +four_bytes_lz4_snappy: + MOVL R10, R11 + SHRL $0x10, R11 + MOVB $0xf8, (AX) + MOVW R10, 1(AX) + MOVB R11, 3(AX) + ADDQ $0x04, AX + JMP memmove_long_lz4_snappy + +three_bytes_lz4_snappy: + MOVB $0xf4, (AX) + MOVW R10, 1(AX) + ADDQ $0x03, AX + JMP memmove_long_lz4_snappy + +two_bytes_lz4_snappy: + MOVB $0xf0, (AX) + MOVB R10, 1(AX) + ADDQ $0x02, AX + CMPL R10, $0x40 + JL memmove_lz4_snappy + JMP memmove_long_lz4_snappy + +one_byte_lz4_snappy: + SHLB $0x02, R10 + MOVB R10, (AX) + ADDQ $0x01, AX + +memmove_lz4_snappy: + LEAQ (AX)(R8*1), R10 + + // genMemMoveShort + CMPQ R8, $0x08 + JLE emit_lit_memmove_lz4_snappy_memmove_move_8 + CMPQ R8, $0x10 + JBE emit_lit_memmove_lz4_snappy_memmove_move_8through16 + CMPQ R8, $0x20 + JBE emit_lit_memmove_lz4_snappy_memmove_move_17through32 + JMP emit_lit_memmove_lz4_snappy_memmove_move_33through64 + +emit_lit_memmove_lz4_snappy_memmove_move_8: + MOVQ (DX), R11 + MOVQ R11, (AX) + JMP memmove_end_copy_lz4_snappy + +emit_lit_memmove_lz4_snappy_memmove_move_8through16: + MOVQ (DX), R11 + MOVQ -8(DX)(R8*1), DX + MOVQ R11, (AX) + MOVQ DX, -8(AX)(R8*1) + JMP memmove_end_copy_lz4_snappy + +emit_lit_memmove_lz4_snappy_memmove_move_17through32: + MOVOU (DX), X0 + MOVOU -16(DX)(R8*1), X1 + MOVOU X0, (AX) + MOVOU X1, -16(AX)(R8*1) + JMP memmove_end_copy_lz4_snappy + +emit_lit_memmove_lz4_snappy_memmove_move_33through64: + MOVOU (DX), X0 + MOVOU 16(DX), X1 + MOVOU -32(DX)(R8*1), X2 + MOVOU -16(DX)(R8*1), X3 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + +memmove_end_copy_lz4_snappy: + MOVQ R10, AX + JMP lz4_snappy_lits_emit_done + +memmove_long_lz4_snappy: + LEAQ (AX)(R8*1), R10 + + // genMemMoveLong + MOVOU (DX), X0 + MOVOU 16(DX), X1 + MOVOU -32(DX)(R8*1), X2 + MOVOU -16(DX)(R8*1), X3 + MOVQ R8, R12 + SHRQ $0x05, R12 + MOVQ AX, R11 + ANDL $0x0000001f, R11 + MOVQ $0x00000040, R13 + SUBQ R11, R13 + DECQ R12 + JA emit_lit_memmove_long_lz4_snappylarge_forward_sse_loop_32 + LEAQ -32(DX)(R13*1), R11 + LEAQ -32(AX)(R13*1), R14 + +emit_lit_memmove_long_lz4_snappylarge_big_loop_back: + MOVOU (R11), X4 + MOVOU 16(R11), X5 + MOVOA X4, (R14) + MOVOA X5, 16(R14) + ADDQ $0x20, R14 + ADDQ $0x20, R11 + ADDQ $0x20, R13 + DECQ R12 + JNA emit_lit_memmove_long_lz4_snappylarge_big_loop_back + +emit_lit_memmove_long_lz4_snappylarge_forward_sse_loop_32: + MOVOU -32(DX)(R13*1), X4 + MOVOU -16(DX)(R13*1), X5 + MOVOA X4, -32(AX)(R13*1) + MOVOA X5, -16(AX)(R13*1) + ADDQ $0x20, R13 + CMPQ R8, R13 + JAE emit_lit_memmove_long_lz4_snappylarge_forward_sse_loop_32 + MOVOU X0, (AX) + MOVOU X1, 16(AX) + MOVOU X2, -32(AX)(R8*1) + MOVOU X3, -16(AX)(R8*1) + MOVQ R10, AX + +lz4_snappy_lits_emit_done: + MOVQ DI, DX + +lz4_snappy_lits_done: + CMPQ DX, BX + JNE lz4_snappy_match + CMPQ R9, $0x04 + JEQ lz4_snappy_done + JMP lz4_snappy_corrupt + +lz4_snappy_match: + LEAQ 2(DX), DI + CMPQ DI, BX + JAE lz4_snappy_corrupt + MOVWQZX (DX), R8 + MOVQ DI, DX + TESTQ R8, R8 + JZ lz4_snappy_corrupt + CMPQ R8, SI + JA lz4_snappy_corrupt + CMPQ R9, $0x13 + JNE lz4_snappy_ml_done + +lz4_snappy_ml_loop: + MOVBQZX (DX), DI + INCQ DX + ADDQ DI, R9 + CMPQ DX, BX + JAE lz4_snappy_corrupt + CMPQ DI, $0xff + JEQ lz4_snappy_ml_loop + +lz4_snappy_ml_done: + ADDQ R9, SI + + // emitCopy +two_byte_offset_lz4_s2: + CMPL R9, $0x40 + JLE two_byte_offset_short_lz4_s2 + MOVB $0xee, (AX) + MOVW R8, 1(AX) + LEAL -60(R9), R9 + ADDQ $0x03, AX + CMPQ AX, CX + JAE lz4_snappy_loop + JMP two_byte_offset_lz4_s2 + +two_byte_offset_short_lz4_s2: + MOVL R9, DI + SHLL $0x02, DI + CMPL R9, $0x0c + JGE emit_copy_three_lz4_s2 + CMPL R8, $0x00000800 + JGE emit_copy_three_lz4_s2 + LEAL -15(DI), DI + MOVB R8, 1(AX) + SHRL $0x08, R8 + SHLL $0x05, R8 + ORL R8, DI + MOVB DI, (AX) + ADDQ $0x02, AX + JMP lz4_snappy_loop + +emit_copy_three_lz4_s2: + LEAL -2(DI), DI + MOVB DI, (AX) + MOVW R8, 1(AX) + ADDQ $0x03, AX + JMP lz4_snappy_loop + +lz4_snappy_done: + MOVQ dst_base+0(FP), CX + SUBQ CX, AX + MOVQ SI, uncompressed+48(FP) + MOVQ AX, dstUsed+56(FP) + RET + +lz4_snappy_corrupt: + XORQ AX, AX + LEAQ -1(AX), SI + MOVQ SI, uncompressed+48(FP) + RET + +lz4_snappy_dstfull: + XORQ AX, AX + LEAQ -2(AX), SI + MOVQ SI, uncompressed+48(FP) + RET diff --git a/vendor/github.com/klauspost/compress/s2/lz4convert.go b/vendor/github.com/klauspost/compress/s2/lz4convert.go new file mode 100644 index 00000000..46ed908e --- /dev/null +++ b/vendor/github.com/klauspost/compress/s2/lz4convert.go @@ -0,0 +1,585 @@ +// Copyright (c) 2022 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package s2 + +import ( + "encoding/binary" + "errors" + "fmt" +) + +// LZ4Converter provides conversion from LZ4 blocks as defined here: +// https://github.com/lz4/lz4/blob/dev/doc/lz4_Block_format.md +type LZ4Converter struct { +} + +// ErrDstTooSmall is returned when provided destination is too small. +var ErrDstTooSmall = errors.New("s2: destination too small") + +// ConvertBlock will convert an LZ4 block and append it as an S2 +// block without block length to dst. +// The uncompressed size is returned as well. +// dst must have capacity to contain the entire compressed block. +func (l *LZ4Converter) ConvertBlock(dst, src []byte) ([]byte, int, error) { + if len(src) == 0 { + return dst, 0, nil + } + const debug = false + const inline = true + const lz4MinMatch = 4 + + s, d := 0, len(dst) + dst = dst[:cap(dst)] + if !debug && hasAmd64Asm { + res, sz := cvtLZ4BlockAsm(dst[d:], src) + if res < 0 { + const ( + errCorrupt = -1 + errDstTooSmall = -2 + ) + switch res { + case errCorrupt: + return nil, 0, ErrCorrupt + case errDstTooSmall: + return nil, 0, ErrDstTooSmall + default: + return nil, 0, fmt.Errorf("unexpected result: %d", res) + } + } + if d+sz > len(dst) { + return nil, 0, ErrDstTooSmall + } + return dst[:d+sz], res, nil + } + + dLimit := len(dst) - 10 + var lastOffset uint16 + var uncompressed int + if debug { + fmt.Printf("convert block start: len(src): %d, len(dst):%d \n", len(src), len(dst)) + } + + for { + if s >= len(src) { + return dst[:d], 0, ErrCorrupt + } + // Read literal info + token := src[s] + ll := int(token >> 4) + ml := int(lz4MinMatch + (token & 0xf)) + + // If upper nibble is 15, literal length is extended + if token >= 0xf0 { + for { + s++ + if s >= len(src) { + if debug { + fmt.Printf("error reading ll: s (%d) >= len(src) (%d)\n", s, len(src)) + } + return dst[:d], 0, ErrCorrupt + } + val := src[s] + ll += int(val) + if val != 255 { + break + } + } + } + // Skip past token + if s+ll >= len(src) { + if debug { + fmt.Printf("error literals: s+ll (%d+%d) >= len(src) (%d)\n", s, ll, len(src)) + } + return nil, 0, ErrCorrupt + } + s++ + if ll > 0 { + if d+ll > dLimit { + return nil, 0, ErrDstTooSmall + } + if debug { + fmt.Printf("emit %d literals\n", ll) + } + d += emitLiteralGo(dst[d:], src[s:s+ll]) + s += ll + uncompressed += ll + } + + // Check if we are done... + if s == len(src) && ml == lz4MinMatch { + break + } + // 2 byte offset + if s >= len(src)-2 { + if debug { + fmt.Printf("s (%d) >= len(src)-2 (%d)", s, len(src)-2) + } + return nil, 0, ErrCorrupt + } + offset := binary.LittleEndian.Uint16(src[s:]) + s += 2 + if offset == 0 { + if debug { + fmt.Printf("error: offset 0, ml: %d, len(src)-s: %d\n", ml, len(src)-s) + } + return nil, 0, ErrCorrupt + } + if int(offset) > uncompressed { + if debug { + fmt.Printf("error: offset (%d)> uncompressed (%d)\n", offset, uncompressed) + } + return nil, 0, ErrCorrupt + } + + if ml == lz4MinMatch+15 { + for { + if s >= len(src) { + if debug { + fmt.Printf("error reading ml: s (%d) >= len(src) (%d)\n", s, len(src)) + } + return nil, 0, ErrCorrupt + } + val := src[s] + s++ + ml += int(val) + if val != 255 { + if s >= len(src) { + if debug { + fmt.Printf("error reading ml: s (%d) >= len(src) (%d)\n", s, len(src)) + } + return nil, 0, ErrCorrupt + } + break + } + } + } + if offset == lastOffset { + if debug { + fmt.Printf("emit repeat, length: %d, offset: %d\n", ml, offset) + } + if !inline { + d += emitRepeat16(dst[d:], offset, ml) + } else { + length := ml + dst := dst[d:] + for len(dst) > 5 { + // Repeat offset, make length cheaper + length -= 4 + if length <= 4 { + dst[0] = uint8(length)<<2 | tagCopy1 + dst[1] = 0 + d += 2 + break + } + if length < 8 && offset < 2048 { + // Encode WITH offset + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(length)<<2 | tagCopy1 + d += 2 + break + } + if length < (1<<8)+4 { + length -= 4 + dst[2] = uint8(length) + dst[1] = 0 + dst[0] = 5<<2 | tagCopy1 + d += 3 + break + } + if length < (1<<16)+(1<<8) { + length -= 1 << 8 + dst[3] = uint8(length >> 8) + dst[2] = uint8(length >> 0) + dst[1] = 0 + dst[0] = 6<<2 | tagCopy1 + d += 4 + break + } + const maxRepeat = (1 << 24) - 1 + length -= 1 << 16 + left := 0 + if length > maxRepeat { + left = length - maxRepeat + 4 + length = maxRepeat - 4 + } + dst[4] = uint8(length >> 16) + dst[3] = uint8(length >> 8) + dst[2] = uint8(length >> 0) + dst[1] = 0 + dst[0] = 7<<2 | tagCopy1 + if left > 0 { + d += 5 + emitRepeat16(dst[5:], offset, left) + break + } + d += 5 + break + } + } + } else { + if debug { + fmt.Printf("emit copy, length: %d, offset: %d\n", ml, offset) + } + if !inline { + d += emitCopy16(dst[d:], offset, ml) + } else { + length := ml + dst := dst[d:] + for len(dst) > 5 { + // Offset no more than 2 bytes. + if length > 64 { + off := 3 + if offset < 2048 { + // emit 8 bytes as tagCopy1, rest as repeats. + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(8-4)<<2 | tagCopy1 + length -= 8 + off = 2 + } else { + // Emit a length 60 copy, encoded as 3 bytes. + // Emit remaining as repeat value (minimum 4 bytes). + dst[2] = uint8(offset >> 8) + dst[1] = uint8(offset) + dst[0] = 59<<2 | tagCopy2 + length -= 60 + } + // Emit remaining as repeats, at least 4 bytes remain. + d += off + emitRepeat16(dst[off:], offset, length) + break + } + if length >= 12 || offset >= 2048 { + // Emit the remaining copy, encoded as 3 bytes. + dst[2] = uint8(offset >> 8) + dst[1] = uint8(offset) + dst[0] = uint8(length-1)<<2 | tagCopy2 + d += 3 + break + } + // Emit the remaining copy, encoded as 2 bytes. + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(length-4)<<2 | tagCopy1 + d += 2 + break + } + } + lastOffset = offset + } + uncompressed += ml + if d > dLimit { + return nil, 0, ErrDstTooSmall + } + } + + return dst[:d], uncompressed, nil +} + +// ConvertBlockSnappy will convert an LZ4 block and append it +// as a Snappy block without block length to dst. +// The uncompressed size is returned as well. +// dst must have capacity to contain the entire compressed block. +func (l *LZ4Converter) ConvertBlockSnappy(dst, src []byte) ([]byte, int, error) { + if len(src) == 0 { + return dst, 0, nil + } + const debug = false + const lz4MinMatch = 4 + + s, d := 0, len(dst) + dst = dst[:cap(dst)] + // Use assembly when possible + if !debug && hasAmd64Asm { + res, sz := cvtLZ4BlockSnappyAsm(dst[d:], src) + if res < 0 { + const ( + errCorrupt = -1 + errDstTooSmall = -2 + ) + switch res { + case errCorrupt: + return nil, 0, ErrCorrupt + case errDstTooSmall: + return nil, 0, ErrDstTooSmall + default: + return nil, 0, fmt.Errorf("unexpected result: %d", res) + } + } + if d+sz > len(dst) { + return nil, 0, ErrDstTooSmall + } + return dst[:d+sz], res, nil + } + + dLimit := len(dst) - 10 + var uncompressed int + if debug { + fmt.Printf("convert block start: len(src): %d, len(dst):%d \n", len(src), len(dst)) + } + + for { + if s >= len(src) { + return nil, 0, ErrCorrupt + } + // Read literal info + token := src[s] + ll := int(token >> 4) + ml := int(lz4MinMatch + (token & 0xf)) + + // If upper nibble is 15, literal length is extended + if token >= 0xf0 { + for { + s++ + if s >= len(src) { + if debug { + fmt.Printf("error reading ll: s (%d) >= len(src) (%d)\n", s, len(src)) + } + return nil, 0, ErrCorrupt + } + val := src[s] + ll += int(val) + if val != 255 { + break + } + } + } + // Skip past token + if s+ll >= len(src) { + if debug { + fmt.Printf("error literals: s+ll (%d+%d) >= len(src) (%d)\n", s, ll, len(src)) + } + return nil, 0, ErrCorrupt + } + s++ + if ll > 0 { + if d+ll > dLimit { + return nil, 0, ErrDstTooSmall + } + if debug { + fmt.Printf("emit %d literals\n", ll) + } + d += emitLiteralGo(dst[d:], src[s:s+ll]) + s += ll + uncompressed += ll + } + + // Check if we are done... + if s == len(src) && ml == lz4MinMatch { + break + } + // 2 byte offset + if s >= len(src)-2 { + if debug { + fmt.Printf("s (%d) >= len(src)-2 (%d)", s, len(src)-2) + } + return nil, 0, ErrCorrupt + } + offset := binary.LittleEndian.Uint16(src[s:]) + s += 2 + if offset == 0 { + if debug { + fmt.Printf("error: offset 0, ml: %d, len(src)-s: %d\n", ml, len(src)-s) + } + return nil, 0, ErrCorrupt + } + if int(offset) > uncompressed { + if debug { + fmt.Printf("error: offset (%d)> uncompressed (%d)\n", offset, uncompressed) + } + return nil, 0, ErrCorrupt + } + + if ml == lz4MinMatch+15 { + for { + if s >= len(src) { + if debug { + fmt.Printf("error reading ml: s (%d) >= len(src) (%d)\n", s, len(src)) + } + return nil, 0, ErrCorrupt + } + val := src[s] + s++ + ml += int(val) + if val != 255 { + if s >= len(src) { + if debug { + fmt.Printf("error reading ml: s (%d) >= len(src) (%d)\n", s, len(src)) + } + return nil, 0, ErrCorrupt + } + break + } + } + } + if debug { + fmt.Printf("emit copy, length: %d, offset: %d\n", ml, offset) + } + length := ml + // d += emitCopyNoRepeat(dst[d:], int(offset), ml) + for length > 0 { + if d >= dLimit { + return nil, 0, ErrDstTooSmall + } + + // Offset no more than 2 bytes. + if length > 64 { + // Emit a length 64 copy, encoded as 3 bytes. + dst[d+2] = uint8(offset >> 8) + dst[d+1] = uint8(offset) + dst[d+0] = 63<<2 | tagCopy2 + length -= 64 + d += 3 + continue + } + if length >= 12 || offset >= 2048 || length < 4 { + // Emit the remaining copy, encoded as 3 bytes. + dst[d+2] = uint8(offset >> 8) + dst[d+1] = uint8(offset) + dst[d+0] = uint8(length-1)<<2 | tagCopy2 + d += 3 + break + } + // Emit the remaining copy, encoded as 2 bytes. + dst[d+1] = uint8(offset) + dst[d+0] = uint8(offset>>8)<<5 | uint8(length-4)<<2 | tagCopy1 + d += 2 + break + } + uncompressed += ml + if d > dLimit { + return nil, 0, ErrDstTooSmall + } + } + + return dst[:d], uncompressed, nil +} + +// emitRepeat writes a repeat chunk and returns the number of bytes written. +// Length must be at least 4 and < 1<<24 +func emitRepeat16(dst []byte, offset uint16, length int) int { + // Repeat offset, make length cheaper + length -= 4 + if length <= 4 { + dst[0] = uint8(length)<<2 | tagCopy1 + dst[1] = 0 + return 2 + } + if length < 8 && offset < 2048 { + // Encode WITH offset + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(length)<<2 | tagCopy1 + return 2 + } + if length < (1<<8)+4 { + length -= 4 + dst[2] = uint8(length) + dst[1] = 0 + dst[0] = 5<<2 | tagCopy1 + return 3 + } + if length < (1<<16)+(1<<8) { + length -= 1 << 8 + dst[3] = uint8(length >> 8) + dst[2] = uint8(length >> 0) + dst[1] = 0 + dst[0] = 6<<2 | tagCopy1 + return 4 + } + const maxRepeat = (1 << 24) - 1 + length -= 1 << 16 + left := 0 + if length > maxRepeat { + left = length - maxRepeat + 4 + length = maxRepeat - 4 + } + dst[4] = uint8(length >> 16) + dst[3] = uint8(length >> 8) + dst[2] = uint8(length >> 0) + dst[1] = 0 + dst[0] = 7<<2 | tagCopy1 + if left > 0 { + return 5 + emitRepeat16(dst[5:], offset, left) + } + return 5 +} + +// emitCopy writes a copy chunk and returns the number of bytes written. +// +// It assumes that: +// +// dst is long enough to hold the encoded bytes +// 1 <= offset && offset <= math.MaxUint16 +// 4 <= length && length <= math.MaxUint32 +func emitCopy16(dst []byte, offset uint16, length int) int { + // Offset no more than 2 bytes. + if length > 64 { + off := 3 + if offset < 2048 { + // emit 8 bytes as tagCopy1, rest as repeats. + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(8-4)<<2 | tagCopy1 + length -= 8 + off = 2 + } else { + // Emit a length 60 copy, encoded as 3 bytes. + // Emit remaining as repeat value (minimum 4 bytes). + dst[2] = uint8(offset >> 8) + dst[1] = uint8(offset) + dst[0] = 59<<2 | tagCopy2 + length -= 60 + } + // Emit remaining as repeats, at least 4 bytes remain. + return off + emitRepeat16(dst[off:], offset, length) + } + if length >= 12 || offset >= 2048 { + // Emit the remaining copy, encoded as 3 bytes. + dst[2] = uint8(offset >> 8) + dst[1] = uint8(offset) + dst[0] = uint8(length-1)<<2 | tagCopy2 + return 3 + } + // Emit the remaining copy, encoded as 2 bytes. + dst[1] = uint8(offset) + dst[0] = uint8(offset>>8)<<5 | uint8(length-4)<<2 | tagCopy1 + return 2 +} + +// emitLiteral writes a literal chunk and returns the number of bytes written. +// +// It assumes that: +// +// dst is long enough to hold the encoded bytes +// 0 <= len(lit) && len(lit) <= math.MaxUint32 +func emitLiteralGo(dst, lit []byte) int { + if len(lit) == 0 { + return 0 + } + i, n := 0, uint(len(lit)-1) + switch { + case n < 60: + dst[0] = uint8(n)<<2 | tagLiteral + i = 1 + case n < 1<<8: + dst[1] = uint8(n) + dst[0] = 60<<2 | tagLiteral + i = 2 + case n < 1<<16: + dst[2] = uint8(n >> 8) + dst[1] = uint8(n) + dst[0] = 61<<2 | tagLiteral + i = 3 + case n < 1<<24: + dst[3] = uint8(n >> 16) + dst[2] = uint8(n >> 8) + dst[1] = uint8(n) + dst[0] = 62<<2 | tagLiteral + i = 4 + default: + dst[4] = uint8(n >> 24) + dst[3] = uint8(n >> 16) + dst[2] = uint8(n >> 8) + dst[1] = uint8(n) + dst[0] = 63<<2 | tagLiteral + i = 5 + } + return i + copy(dst[i:], lit) +} diff --git a/vendor/github.com/klauspost/compress/zstd/README.md b/vendor/github.com/klauspost/compress/zstd/README.md index beb7fa87..65b38abe 100644 --- a/vendor/github.com/klauspost/compress/zstd/README.md +++ b/vendor/github.com/klauspost/compress/zstd/README.md @@ -12,6 +12,8 @@ The `zstd` package is provided as open source software using a Go standard licen Currently the package is heavily optimized for 64 bit processors and will be significantly slower on 32 bit processors. +For seekable zstd streams, see [this excellent package](https://github.com/SaveTheRbtz/zstd-seekable-format-go). + ## Installation Install using `go get -u github.com/klauspost/compress`. The package is located in `github.com/klauspost/compress/zstd`. diff --git a/vendor/github.com/klauspost/compress/zstd/blockdec.go b/vendor/github.com/klauspost/compress/zstd/blockdec.go index 7eed729b..2445bb4f 100644 --- a/vendor/github.com/klauspost/compress/zstd/blockdec.go +++ b/vendor/github.com/klauspost/compress/zstd/blockdec.go @@ -10,7 +10,6 @@ import ( "errors" "fmt" "io" - "io/ioutil" "os" "path/filepath" "sync" @@ -83,8 +82,9 @@ type blockDec struct { err error - // Check against this crc - checkCRC []byte + // Check against this crc, if hasCRC is true. + checkCRC uint32 + hasCRC bool // Frame to use for singlethreaded decoding. // Should not be used by the decoder itself since parent may be another frame. @@ -192,16 +192,14 @@ func (b *blockDec) reset(br byteBuffer, windowSize uint64) error { } // Read block data. - if cap(b.dataStorage) < cSize { + if _, ok := br.(*byteBuf); !ok && cap(b.dataStorage) < cSize { + // byteBuf doesn't need a destination buffer. if b.lowMem || cSize > maxCompressedBlockSize { b.dataStorage = make([]byte, 0, cSize+compressedBlockOverAlloc) } else { b.dataStorage = make([]byte, 0, maxCompressedBlockSizeAlloc) } } - if cap(b.dst) <= maxSize { - b.dst = make([]byte, 0, maxSize+1) - } b.data, err = br.readBig(cSize, b.dataStorage) if err != nil { if debugDecoder { @@ -210,6 +208,9 @@ func (b *blockDec) reset(br byteBuffer, windowSize uint64) error { } return err } + if cap(b.dst) <= maxSize { + b.dst = make([]byte, 0, maxSize+1) + } return nil } @@ -233,7 +234,7 @@ func (b *blockDec) decodeBuf(hist *history) error { if b.lowMem { b.dst = make([]byte, b.RLESize) } else { - b.dst = make([]byte, maxBlockSize) + b.dst = make([]byte, maxCompressedBlockSize) } } b.dst = b.dst[:b.RLESize] @@ -651,7 +652,7 @@ func (b *blockDec) prepareSequences(in []byte, hist *history) (err error) { fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.matchLengths.fse)) fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.offsets.fse)) buf.Write(in) - ioutil.WriteFile(filepath.Join("testdata", "seqs", fn), buf.Bytes(), os.ModePerm) + os.WriteFile(filepath.Join("testdata", "seqs", fn), buf.Bytes(), os.ModePerm) } return nil diff --git a/vendor/github.com/klauspost/compress/zstd/bytebuf.go b/vendor/github.com/klauspost/compress/zstd/bytebuf.go index 4493baa7..176788f2 100644 --- a/vendor/github.com/klauspost/compress/zstd/bytebuf.go +++ b/vendor/github.com/klauspost/compress/zstd/bytebuf.go @@ -7,7 +7,6 @@ package zstd import ( "fmt" "io" - "io/ioutil" ) type byteBuffer interface { @@ -23,7 +22,7 @@ type byteBuffer interface { readByte() (byte, error) // Skip n bytes. - skipN(n int) error + skipN(n int64) error } // in-memory buffer @@ -62,9 +61,12 @@ func (b *byteBuf) readByte() (byte, error) { return r, nil } -func (b *byteBuf) skipN(n int) error { +func (b *byteBuf) skipN(n int64) error { bb := *b - if len(bb) < n { + if n < 0 { + return fmt.Errorf("negative skip (%d) requested", n) + } + if int64(len(bb)) < n { return io.ErrUnexpectedEOF } *b = bb[n:] @@ -120,9 +122,9 @@ func (r *readerWrapper) readByte() (byte, error) { return r.tmp[0], nil } -func (r *readerWrapper) skipN(n int) error { - n2, err := io.CopyN(ioutil.Discard, r.r, int64(n)) - if n2 != int64(n) { +func (r *readerWrapper) skipN(n int64) error { + n2, err := io.CopyN(io.Discard, r.r, n) + if n2 != n { err = io.ErrUnexpectedEOF } return err diff --git a/vendor/github.com/klauspost/compress/zstd/decodeheader.go b/vendor/github.com/klauspost/compress/zstd/decodeheader.go index 5022e71c..f6a24097 100644 --- a/vendor/github.com/klauspost/compress/zstd/decodeheader.go +++ b/vendor/github.com/klauspost/compress/zstd/decodeheader.go @@ -4,7 +4,6 @@ package zstd import ( - "bytes" "encoding/binary" "errors" "io" @@ -102,8 +101,8 @@ func (h *Header) Decode(in []byte) error { } h.HeaderSize += 4 b, in := in[:4], in[4:] - if !bytes.Equal(b, frameMagic) { - if !bytes.Equal(b[1:4], skippableFrameMagic) || b[0]&0xf0 != 0x50 { + if string(b) != frameMagic { + if string(b[1:4]) != skippableFrameMagic || b[0]&0xf0 != 0x50 { return ErrMagicMismatch } if len(in) < 4 { @@ -153,7 +152,7 @@ func (h *Header) Decode(in []byte) error { } b, in = in[:size], in[size:] h.HeaderSize += int(size) - switch size { + switch len(b) { case 1: h.DictionaryID = uint32(b[0]) case 2: @@ -183,7 +182,7 @@ func (h *Header) Decode(in []byte) error { } b, in = in[:fcsSize], in[fcsSize:] h.HeaderSize += int(fcsSize) - switch fcsSize { + switch len(b) { case 1: h.FrameContentSize = uint64(b[0]) case 2: diff --git a/vendor/github.com/klauspost/compress/zstd/decoder.go b/vendor/github.com/klauspost/compress/zstd/decoder.go index 286c8f9d..7113e69e 100644 --- a/vendor/github.com/klauspost/compress/zstd/decoder.go +++ b/vendor/github.com/klauspost/compress/zstd/decoder.go @@ -5,7 +5,6 @@ package zstd import ( - "bytes" "context" "encoding/binary" "io" @@ -35,13 +34,13 @@ type Decoder struct { br readerWrapper enabled bool inFrame bool + dstBuf []byte } frame *frameDec // Custom dictionaries. - // Always uses copies. - dicts map[uint32]dict + dicts map[uint32]*dict // streamWg is the waitgroup for all streams streamWg sync.WaitGroup @@ -103,7 +102,7 @@ func NewReader(r io.Reader, opts ...DOption) (*Decoder, error) { } // Transfer option dicts. - d.dicts = make(map[uint32]dict, len(d.o.dicts)) + d.dicts = make(map[uint32]*dict, len(d.o.dicts)) for _, dc := range d.o.dicts { d.dicts[dc.id] = dc } @@ -187,21 +186,23 @@ func (d *Decoder) Reset(r io.Reader) error { } // If bytes buffer and < 5MB, do sync decoding anyway. - if bb, ok := r.(byter); ok && bb.Len() < 5<<20 { + if bb, ok := r.(byter); ok && bb.Len() < d.o.decodeBufsBelow && !d.o.limitToCap { bb2 := bb if debugDecoder { println("*bytes.Buffer detected, doing sync decode, len:", bb.Len()) } b := bb2.Bytes() var dst []byte - if cap(d.current.b) > 0 { - dst = d.current.b + if cap(d.syncStream.dstBuf) > 0 { + dst = d.syncStream.dstBuf[:0] } - dst, err := d.DecodeAll(b, dst[:0]) + dst, err := d.DecodeAll(b, dst) if err == nil { err = io.EOF } + // Save output buffer + d.syncStream.dstBuf = dst d.current.b = dst d.current.err = err d.current.flushed = true @@ -216,6 +217,7 @@ func (d *Decoder) Reset(r io.Reader) error { d.current.err = nil d.current.flushed = false d.current.d = nil + d.syncStream.dstBuf = nil // Ensure no-one else is still running... d.streamWg.Wait() @@ -312,6 +314,7 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { // Grab a block decoder and frame decoder. block := <-d.decoders frame := block.localFrame + initialSize := len(dst) defer func() { if debugDecoder { printf("re-adding decoder: %p", block) @@ -337,21 +340,26 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { } return dst, err } - if frame.DictionaryID != nil { - dict, ok := d.dicts[*frame.DictionaryID] - if !ok { - return nil, ErrUnknownDictionary - } - if debugDecoder { - println("setting dict", frame.DictionaryID) - } - frame.history.setDict(&dict) + if err = d.setDict(frame); err != nil { + return nil, err } if frame.WindowSize > d.o.maxWindowSize { + if debugDecoder { + println("window size exceeded:", frame.WindowSize, ">", d.o.maxWindowSize) + } return dst, ErrWindowSizeExceeded } if frame.FrameContentSize != fcsUnknown { - if frame.FrameContentSize > d.o.maxDecodedSize-uint64(len(dst)) { + if frame.FrameContentSize > d.o.maxDecodedSize-uint64(len(dst)-initialSize) { + if debugDecoder { + println("decoder size exceeded; fcs:", frame.FrameContentSize, "> mcs:", d.o.maxDecodedSize-uint64(len(dst)-initialSize), "len:", len(dst)) + } + return dst, ErrDecoderSizeExceeded + } + if d.o.limitToCap && frame.FrameContentSize > uint64(cap(dst)-len(dst)) { + if debugDecoder { + println("decoder size exceeded; fcs:", frame.FrameContentSize, "> (cap-len)", cap(dst)-len(dst)) + } return dst, ErrDecoderSizeExceeded } if cap(dst)-len(dst) < int(frame.FrameContentSize) { @@ -361,7 +369,7 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { } } - if cap(dst) == 0 { + if cap(dst) == 0 && !d.o.limitToCap { // Allocate len(input) * 2 by default if nothing is provided // and we didn't get frame content size. size := len(input) * 2 @@ -379,6 +387,9 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { if err != nil { return dst, err } + if uint64(len(dst)-initialSize) > d.o.maxDecodedSize { + return dst, ErrDecoderSizeExceeded + } if len(frame.bBuf) == 0 { if debugDecoder { println("frame dbuf empty") @@ -439,7 +450,11 @@ func (d *Decoder) nextBlock(blocking bool) (ok bool) { println("got", len(d.current.b), "bytes, error:", d.current.err, "data crc:", tmp) } - if !d.o.ignoreChecksum && len(next.b) > 0 { + if d.o.ignoreChecksum { + return true + } + + if len(next.b) > 0 { n, err := d.current.crc.Write(next.b) if err == nil { if n != len(next.b) { @@ -447,18 +462,16 @@ func (d *Decoder) nextBlock(blocking bool) (ok bool) { } } } - if next.err == nil && next.d != nil && len(next.d.checkCRC) != 0 { - got := d.current.crc.Sum64() - var tmp [4]byte - binary.LittleEndian.PutUint32(tmp[:], uint32(got)) - if !d.o.ignoreChecksum && !bytes.Equal(tmp[:], next.d.checkCRC) { + if next.err == nil && next.d != nil && next.d.hasCRC { + got := uint32(d.current.crc.Sum64()) + if got != next.d.checkCRC { if debugDecoder { - println("CRC Check Failed:", tmp[:], " (got) !=", next.d.checkCRC, "(on stream)") + printf("CRC Check Failed: %08x (got) != %08x (on stream)\n", got, next.d.checkCRC) } d.current.err = ErrCRCMismatch } else { if debugDecoder { - println("CRC ok", tmp[:]) + printf("CRC ok %08x\n", got) } } } @@ -474,18 +487,12 @@ func (d *Decoder) nextBlockSync() (ok bool) { if !d.syncStream.inFrame { d.frame.history.reset() d.current.err = d.frame.reset(&d.syncStream.br) + if d.current.err == nil { + d.current.err = d.setDict(d.frame) + } if d.current.err != nil { return false } - if d.frame.DictionaryID != nil { - dict, ok := d.dicts[*d.frame.DictionaryID] - if !ok { - d.current.err = ErrUnknownDictionary - return false - } else { - d.frame.history.setDict(&dict) - } - } if d.frame.WindowSize > d.o.maxDecodedSize || d.frame.WindowSize > d.o.maxWindowSize { d.current.err = ErrDecoderSizeExceeded return false @@ -664,6 +671,7 @@ func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output ch if debugDecoder { println("Async 1: new history, recent:", block.async.newHist.recentOffsets) } + hist.reset() hist.decoders = block.async.newHist.decoders hist.recentOffsets = block.async.newHist.recentOffsets hist.windowSize = block.async.newHist.windowSize @@ -695,6 +703,7 @@ func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output ch seqExecute <- block } close(seqExecute) + hist.reset() }() var wg sync.WaitGroup @@ -718,6 +727,7 @@ func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output ch if debugDecoder { println("Async 2: new history") } + hist.reset() hist.windowSize = block.async.newHist.windowSize hist.allocFrameBuffer = block.async.newHist.allocFrameBuffer if block.async.newHist.dict != nil { @@ -747,7 +757,7 @@ func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output ch if block.lowMem { block.dst = make([]byte, block.RLESize) } else { - block.dst = make([]byte, maxBlockSize) + block.dst = make([]byte, maxCompressedBlockSize) } } block.dst = block.dst[:block.RLESize] @@ -799,13 +809,14 @@ func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output ch if debugDecoder { println("decoder goroutines finished") } + hist.reset() }() + var hist history decodeStream: for { - var hist history var hasErr bool - + hist.reset() decodeBlock := func(block *blockDec) { if hasErr { if block != nil { @@ -840,15 +851,14 @@ decodeStream: if debugDecoder && err != nil { println("Frame decoder returned", err) } - if err == nil && frame.DictionaryID != nil { - dict, ok := d.dicts[*frame.DictionaryID] - if !ok { - err = ErrUnknownDictionary - } else { - frame.history.setDict(&dict) - } + if err == nil { + err = d.setDict(frame) } if err == nil && d.frame.WindowSize > d.o.maxWindowSize { + if debugDecoder { + println("decoder size exceeded, fws:", d.frame.WindowSize, "> mws:", d.o.maxWindowSize) + } + err = ErrDecoderSizeExceeded } if err != nil { @@ -890,18 +900,22 @@ decodeStream: println("next block returned error:", err) } dec.err = err - dec.checkCRC = nil + dec.hasCRC = false if dec.Last && frame.HasCheckSum && err == nil { crc, err := frame.rawInput.readSmall(4) - if err != nil { + if len(crc) < 4 { + if err == nil { + err = io.ErrUnexpectedEOF + + } println("CRC missing?", err) dec.err = err - } - var tmp [4]byte - copy(tmp[:], crc) - dec.checkCRC = tmp[:] - if debugDecoder { - println("found crc to check:", dec.checkCRC) + } else { + dec.checkCRC = binary.LittleEndian.Uint32(crc) + dec.hasCRC = true + if debugDecoder { + printf("found crc to check: %08x\n", dec.checkCRC) + } } } err = dec.err @@ -917,5 +931,23 @@ decodeStream: } close(seqDecode) wg.Wait() + hist.reset() d.frame.history.b = frameHistCache } + +func (d *Decoder) setDict(frame *frameDec) (err error) { + dict, ok := d.dicts[frame.DictionaryID] + if ok { + if debugDecoder { + println("setting dict", frame.DictionaryID) + } + frame.history.setDict(dict) + } else if frame.DictionaryID != 0 { + // A zero or missing dictionary id is ambiguous: + // either dictionary zero, or no dictionary. In particular, + // zstd --patch-from uses this id for the source file, + // so only return an error if the dictionary id is not zero. + err = ErrUnknownDictionary + } + return err +} diff --git a/vendor/github.com/klauspost/compress/zstd/decoder_options.go b/vendor/github.com/klauspost/compress/zstd/decoder_options.go index c70e6fa0..07a90dd7 100644 --- a/vendor/github.com/klauspost/compress/zstd/decoder_options.go +++ b/vendor/github.com/klauspost/compress/zstd/decoder_options.go @@ -6,6 +6,8 @@ package zstd import ( "errors" + "fmt" + "math/bits" "runtime" ) @@ -14,20 +16,23 @@ type DOption func(*decoderOptions) error // options retains accumulated state of multiple options. type decoderOptions struct { - lowMem bool - concurrent int - maxDecodedSize uint64 - maxWindowSize uint64 - dicts []dict - ignoreChecksum bool + lowMem bool + concurrent int + maxDecodedSize uint64 + maxWindowSize uint64 + dicts []*dict + ignoreChecksum bool + limitToCap bool + decodeBufsBelow int } func (o *decoderOptions) setDefault() { *o = decoderOptions{ // use less ram: true for now, but may change. - lowMem: true, - concurrent: runtime.GOMAXPROCS(0), - maxWindowSize: MaxWindowSize, + lowMem: true, + concurrent: runtime.GOMAXPROCS(0), + maxWindowSize: MaxWindowSize, + decodeBufsBelow: 128 << 10, } if o.concurrent > 4 { o.concurrent = 4 @@ -82,7 +87,13 @@ func WithDecoderMaxMemory(n uint64) DOption { } // WithDecoderDicts allows to register one or more dictionaries for the decoder. -// If several dictionaries with the same ID is provided the last one will be used. +// +// Each slice in dict must be in the [dictionary format] produced by +// "zstd --train" from the Zstandard reference implementation. +// +// If several dictionaries with the same ID are provided, the last one will be used. +// +// [dictionary format]: https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary-format func WithDecoderDicts(dicts ...[]byte) DOption { return func(o *decoderOptions) error { for _, b := range dicts { @@ -90,12 +101,24 @@ func WithDecoderDicts(dicts ...[]byte) DOption { if err != nil { return err } - o.dicts = append(o.dicts, *d) + o.dicts = append(o.dicts, d) } return nil } } +// WithEncoderDictRaw registers a dictionary that may be used by the decoder. +// The slice content can be arbitrary data. +func WithDecoderDictRaw(id uint32, content []byte) DOption { + return func(o *decoderOptions) error { + if bits.UintSize > 32 && uint(len(content)) > dictMaxLength { + return fmt.Errorf("dictionary of size %d > 2GiB too large", len(content)) + } + o.dicts = append(o.dicts, &dict{id: id, content: content, offsets: [3]int{1, 4, 8}}) + return nil + } +} + // WithDecoderMaxWindow allows to set a maximum window size for decodes. // This allows rejecting packets that will cause big memory usage. // The Decoder will likely allocate more memory based on the WithDecoderLowmem setting. @@ -114,6 +137,29 @@ func WithDecoderMaxWindow(size uint64) DOption { } } +// WithDecodeAllCapLimit will limit DecodeAll to decoding cap(dst)-len(dst) bytes, +// or any size set in WithDecoderMaxMemory. +// This can be used to limit decoding to a specific maximum output size. +// Disabled by default. +func WithDecodeAllCapLimit(b bool) DOption { + return func(o *decoderOptions) error { + o.limitToCap = b + return nil + } +} + +// WithDecodeBuffersBelow will fully decode readers that have a +// `Bytes() []byte` and `Len() int` interface similar to bytes.Buffer. +// This typically uses less allocations but will have the full decompressed object in memory. +// Note that DecodeAllCapLimit will disable this, as well as giving a size of 0 or less. +// Default is 128KiB. +func WithDecodeBuffersBelow(size int) DOption { + return func(o *decoderOptions) error { + o.decodeBufsBelow = size + return nil + } +} + // IgnoreChecksum allows to forcibly ignore checksum checking. func IgnoreChecksum(b bool) DOption { return func(o *decoderOptions) error { diff --git a/vendor/github.com/klauspost/compress/zstd/dict.go b/vendor/github.com/klauspost/compress/zstd/dict.go index a36ae83e..ca095145 100644 --- a/vendor/github.com/klauspost/compress/zstd/dict.go +++ b/vendor/github.com/klauspost/compress/zstd/dict.go @@ -1,7 +1,6 @@ package zstd import ( - "bytes" "encoding/binary" "errors" "fmt" @@ -20,7 +19,10 @@ type dict struct { content []byte } -var dictMagic = [4]byte{0x37, 0xa4, 0x30, 0xec} +const dictMagic = "\x37\xa4\x30\xec" + +// Maximum dictionary size for the reference implementation (1.5.3) is 2 GiB. +const dictMaxLength = 1 << 31 // ID returns the dictionary id or 0 if d is nil. func (d *dict) ID() uint32 { @@ -30,14 +32,38 @@ func (d *dict) ID() uint32 { return d.id } -// DictContentSize returns the dictionary content size or 0 if d is nil. -func (d *dict) DictContentSize() int { +// ContentSize returns the dictionary content size or 0 if d is nil. +func (d *dict) ContentSize() int { if d == nil { return 0 } return len(d.content) } +// Content returns the dictionary content. +func (d *dict) Content() []byte { + if d == nil { + return nil + } + return d.content +} + +// Offsets returns the initial offsets. +func (d *dict) Offsets() [3]int { + if d == nil { + return [3]int{} + } + return d.offsets +} + +// LitEncoder returns the literal encoder. +func (d *dict) LitEncoder() *huff0.Scratch { + if d == nil { + return nil + } + return d.litEnc +} + // Load a dictionary as described in // https://github.com/facebook/zstd/blob/master/doc/zstd_compression_format.md#dictionary-format func loadDict(b []byte) (*dict, error) { @@ -50,7 +76,7 @@ func loadDict(b []byte) (*dict, error) { ofDec: sequenceDec{fse: &fseDecoder{}}, mlDec: sequenceDec{fse: &fseDecoder{}}, } - if !bytes.Equal(b[:4], dictMagic[:]) { + if string(b[:4]) != dictMagic { return nil, ErrMagicMismatch } d.id = binary.LittleEndian.Uint32(b[4:8]) @@ -62,7 +88,7 @@ func loadDict(b []byte) (*dict, error) { var err error d.litEnc, b, err = huff0.ReadTable(b[8:], nil) if err != nil { - return nil, err + return nil, fmt.Errorf("loading literal table: %w", err) } d.litEnc.Reuse = huff0.ReusePolicyMust @@ -120,3 +146,16 @@ func loadDict(b []byte) (*dict, error) { return &d, nil } + +// InspectDictionary loads a zstd dictionary and provides functions to inspect the content. +func InspectDictionary(b []byte) (interface { + ID() uint32 + ContentSize() int + Content() []byte + Offsets() [3]int + LitEncoder() *huff0.Scratch +}, error) { + initPredefined() + d, err := loadDict(b) + return d, err +} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_base.go b/vendor/github.com/klauspost/compress/zstd/enc_base.go index 15ae8ee8..e008b992 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_base.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_base.go @@ -16,6 +16,7 @@ type fastBase struct { cur int32 // maximum offset. Should be at least 2x block size. maxMatchOff int32 + bufferReset int32 hist []byte crc *xxhash.Digest tmp [8]byte @@ -56,8 +57,8 @@ func (e *fastBase) Block() *blockEnc { } func (e *fastBase) addBlock(src []byte) int32 { - if debugAsserts && e.cur > bufferReset { - panic(fmt.Sprintf("ecur (%d) > buffer reset (%d)", e.cur, bufferReset)) + if debugAsserts && e.cur > e.bufferReset { + panic(fmt.Sprintf("ecur (%d) > buffer reset (%d)", e.cur, e.bufferReset)) } // check if we have space already if len(e.hist)+len(src) > cap(e.hist) { @@ -126,24 +127,7 @@ func (e *fastBase) matchlen(s, t int32, src []byte) int32 { panic(fmt.Sprintf("len(src)-s (%d) > maxCompressedBlockSize (%d)", len(src)-int(s), maxCompressedBlockSize)) } } - a := src[s:] - b := src[t:] - b = b[:len(a)] - end := int32((len(a) >> 3) << 3) - for i := int32(0); i < end; i += 8 { - if diff := load6432(a, i) ^ load6432(b, i); diff != 0 { - return i + int32(bits.TrailingZeros64(diff)>>3) - } - } - - a = a[end:] - b = b[end:] - for i := range a { - if a[i] != b[i] { - return int32(i) + end - } - } - return int32(len(a)) + end + return int32(matchLen(src[s:], src[t:])) } // Reset the encoding table. @@ -165,13 +149,13 @@ func (e *fastBase) resetBase(d *dict, singleBlock bool) { if singleBlock { e.lowMem = true } - e.ensureHist(d.DictContentSize() + maxCompressedBlockSize) + e.ensureHist(d.ContentSize() + maxCompressedBlockSize) e.lowMem = low } // We offset current position so everything will be out of reach. // If above reset line, history will be purged. - if e.cur < bufferReset { + if e.cur < e.bufferReset { e.cur += e.maxMatchOff + int32(len(e.hist)) } e.hist = e.hist[:0] diff --git a/vendor/github.com/klauspost/compress/zstd/enc_best.go b/vendor/github.com/klauspost/compress/zstd/enc_best.go index 96028ecd..830f5ba7 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_best.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_best.go @@ -32,6 +32,7 @@ type match struct { length int32 rep int32 est int32 + _ [12]byte // Aligned size to cache line: 4+4+4+4+4 bytes + 12 bytes padding = 32 bytes } const highScore = 25000 @@ -84,14 +85,10 @@ func (e *bestFastEncoder) Encode(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { - for i := range e.table[:] { - e.table[i] = prevEntry{} - } - for i := range e.longTable[:] { - e.longTable[i] = prevEntry{} - } + e.table = [bestShortTableSize]prevEntry{} + e.longTable = [bestLongTableSize]prevEntry{} e.cur = e.maxMatchOff break } @@ -192,8 +189,8 @@ encodeLoop: panic("offset0 was 0") } - bestOf := func(a, b match) match { - if a.est+(a.s-b.s)*bitsPerByte>>10 < b.est+(b.s-a.s)*bitsPerByte>>10 { + bestOf := func(a, b *match) *match { + if a.est-b.est+(a.s-b.s)*bitsPerByte>>10 < 0 { return a } return b @@ -219,22 +216,26 @@ encodeLoop: return m } - best := bestOf(matchAt(candidateL.offset-e.cur, s, uint32(cv), -1), matchAt(candidateL.prev-e.cur, s, uint32(cv), -1)) - best = bestOf(best, matchAt(candidateS.offset-e.cur, s, uint32(cv), -1)) - best = bestOf(best, matchAt(candidateS.prev-e.cur, s, uint32(cv), -1)) + m1 := matchAt(candidateL.offset-e.cur, s, uint32(cv), -1) + m2 := matchAt(candidateL.prev-e.cur, s, uint32(cv), -1) + m3 := matchAt(candidateS.offset-e.cur, s, uint32(cv), -1) + m4 := matchAt(candidateS.prev-e.cur, s, uint32(cv), -1) + best := bestOf(bestOf(&m1, &m2), bestOf(&m3, &m4)) if canRepeat && best.length < goodEnough { cv32 := uint32(cv >> 8) spp := s + 1 - best = bestOf(best, matchAt(spp-offset1, spp, cv32, 1)) - best = bestOf(best, matchAt(spp-offset2, spp, cv32, 2)) - best = bestOf(best, matchAt(spp-offset3, spp, cv32, 3)) + m1 := matchAt(spp-offset1, spp, cv32, 1) + m2 := matchAt(spp-offset2, spp, cv32, 2) + m3 := matchAt(spp-offset3, spp, cv32, 3) + best = bestOf(bestOf(best, &m1), bestOf(&m2, &m3)) if best.length > 0 { cv32 = uint32(cv >> 24) spp += 2 - best = bestOf(best, matchAt(spp-offset1, spp, cv32, 1)) - best = bestOf(best, matchAt(spp-offset2, spp, cv32, 2)) - best = bestOf(best, matchAt(spp-offset3, spp, cv32, 3)) + m1 := matchAt(spp-offset1, spp, cv32, 1) + m2 := matchAt(spp-offset2, spp, cv32, 2) + m3 := matchAt(spp-offset3, spp, cv32, 3) + best = bestOf(bestOf(best, &m1), bestOf(&m2, &m3)) } } // Load next and check... @@ -261,26 +262,33 @@ encodeLoop: candidateL2 := e.longTable[hashLen(cv2, bestLongTableBits, bestLongLen)] // Short at s+1 - best = bestOf(best, matchAt(candidateS.offset-e.cur, s, uint32(cv), -1)) + m1 := matchAt(candidateS.offset-e.cur, s, uint32(cv), -1) // Long at s+1, s+2 - best = bestOf(best, matchAt(candidateL.offset-e.cur, s, uint32(cv), -1)) - best = bestOf(best, matchAt(candidateL.prev-e.cur, s, uint32(cv), -1)) - best = bestOf(best, matchAt(candidateL2.offset-e.cur, s+1, uint32(cv2), -1)) - best = bestOf(best, matchAt(candidateL2.prev-e.cur, s+1, uint32(cv2), -1)) + m2 := matchAt(candidateL.offset-e.cur, s, uint32(cv), -1) + m3 := matchAt(candidateL.prev-e.cur, s, uint32(cv), -1) + m4 := matchAt(candidateL2.offset-e.cur, s+1, uint32(cv2), -1) + m5 := matchAt(candidateL2.prev-e.cur, s+1, uint32(cv2), -1) + best = bestOf(bestOf(bestOf(best, &m1), &m2), bestOf(bestOf(&m3, &m4), &m5)) if false { // Short at s+3. // Too often worse... - best = bestOf(best, matchAt(e.table[hashLen(cv2>>8, bestShortTableBits, bestShortLen)].offset-e.cur, s+2, uint32(cv2>>8), -1)) + m := matchAt(e.table[hashLen(cv2>>8, bestShortTableBits, bestShortLen)].offset-e.cur, s+2, uint32(cv2>>8), -1) + best = bestOf(best, &m) } // See if we can find a better match by checking where the current best ends. // Use that offset to see if we can find a better full match. if sAt := best.s + best.length; sAt < sLimit { nextHashL := hashLen(load6432(src, sAt), bestLongTableBits, bestLongLen) candidateEnd := e.longTable[nextHashL] - if pos := candidateEnd.offset - e.cur - best.length; pos >= 0 { - bestEnd := bestOf(best, matchAt(pos, best.s, load3232(src, best.s), -1)) - if pos := candidateEnd.prev - e.cur - best.length; pos >= 0 { - bestEnd = bestOf(bestEnd, matchAt(pos, best.s, load3232(src, best.s), -1)) + // Start check at a fixed offset to allow for a few mismatches. + // For this compression level 2 yields the best results. + const skipBeginning = 2 + if pos := candidateEnd.offset - e.cur - best.length + skipBeginning; pos >= 0 { + m := matchAt(pos, best.s+skipBeginning, load3232(src, best.s+skipBeginning), -1) + bestEnd := bestOf(best, &m) + if pos := candidateEnd.prev - e.cur - best.length + skipBeginning; pos >= 0 { + m := matchAt(pos, best.s+skipBeginning, load3232(src, best.s+skipBeginning), -1) + bestEnd = bestOf(bestEnd, &m) } best = bestEnd } diff --git a/vendor/github.com/klauspost/compress/zstd/enc_better.go b/vendor/github.com/klauspost/compress/zstd/enc_better.go index c769f694..8582f31a 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_better.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_better.go @@ -62,14 +62,10 @@ func (e *betterFastEncoder) Encode(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { - for i := range e.table[:] { - e.table[i] = tableEntry{} - } - for i := range e.longTable[:] { - e.longTable[i] = prevEntry{} - } + e.table = [betterShortTableSize]tableEntry{} + e.longTable = [betterLongTableSize]prevEntry{} e.cur = e.maxMatchOff break } @@ -416,15 +412,23 @@ encodeLoop: // Try to find a better match by searching for a long match at the end of the current best match if s+matched < sLimit { + // Allow some bytes at the beginning to mismatch. + // Sweet spot is around 3 bytes, but depends on input. + // The skipped bytes are tested in Extend backwards, + // and still picked up as part of the match if they do. + const skipBeginning = 3 + nextHashL := hashLen(load6432(src, s+matched), betterLongTableBits, betterLongLen) - cv := load3232(src, s) + s2 := s + skipBeginning + cv := load3232(src, s2) candidateL := e.longTable[nextHashL] - coffsetL := candidateL.offset - e.cur - matched - if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + coffsetL := candidateL.offset - e.cur - matched + skipBeginning + if coffsetL >= 0 && coffsetL < s2 && s2-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { // Found a long match, at least 4 bytes. - matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + matchedNext := e.matchlen(s2+4, coffsetL+4, src) + 4 if matchedNext > matched { t = coffsetL + s = s2 matched = matchedNext if debugMatches { println("long match at end-of-match") @@ -434,12 +438,13 @@ encodeLoop: // Check prev long... if true { - coffsetL = candidateL.prev - e.cur - matched - if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + coffsetL = candidateL.prev - e.cur - matched + skipBeginning + if coffsetL >= 0 && coffsetL < s2 && s2-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { // Found a long match, at least 4 bytes. - matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + matchedNext := e.matchlen(s2+4, coffsetL+4, src) + 4 if matchedNext > matched { t = coffsetL + s = s2 matched = matchedNext if debugMatches { println("prev long match at end-of-match") @@ -578,7 +583,7 @@ func (e *betterFastEncoderDict) Encode(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { for i := range e.table[:] { e.table[i] = tableEntry{} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_dfast.go b/vendor/github.com/klauspost/compress/zstd/enc_dfast.go index 7ff0c64f..7d425109 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_dfast.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_dfast.go @@ -44,14 +44,10 @@ func (e *doubleFastEncoder) Encode(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { - for i := range e.table[:] { - e.table[i] = tableEntry{} - } - for i := range e.longTable[:] { - e.longTable[i] = tableEntry{} - } + e.table = [dFastShortTableSize]tableEntry{} + e.longTable = [dFastLongTableSize]tableEntry{} e.cur = e.maxMatchOff break } @@ -388,7 +384,7 @@ func (e *doubleFastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - if e.cur >= bufferReset { + if e.cur >= e.bufferReset { for i := range e.table[:] { e.table[i] = tableEntry{} } @@ -685,7 +681,7 @@ encodeLoop: } // We do not store history, so we must offset e.cur to avoid false matches for next user. - if e.cur < bufferReset { + if e.cur < e.bufferReset { e.cur += int32(len(src)) } } @@ -700,7 +696,7 @@ func (e *doubleFastEncoderDict) Encode(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { for i := range e.table[:] { e.table[i] = tableEntry{} @@ -1103,7 +1099,8 @@ func (e *doubleFastEncoderDict) Reset(d *dict, singleBlock bool) { } if allDirty || dirtyShardCnt > dLongTableShardCnt/2 { - copy(e.longTable[:], e.dictLongTable) + //copy(e.longTable[:], e.dictLongTable) + e.longTable = *(*[dFastLongTableSize]tableEntry)(e.dictLongTable) for i := range e.longTableShardDirty { e.longTableShardDirty[i] = false } @@ -1114,7 +1111,9 @@ func (e *doubleFastEncoderDict) Reset(d *dict, singleBlock bool) { continue } - copy(e.longTable[i*dLongTableShardSize:(i+1)*dLongTableShardSize], e.dictLongTable[i*dLongTableShardSize:(i+1)*dLongTableShardSize]) + // copy(e.longTable[i*dLongTableShardSize:(i+1)*dLongTableShardSize], e.dictLongTable[i*dLongTableShardSize:(i+1)*dLongTableShardSize]) + *(*[dLongTableShardSize]tableEntry)(e.longTable[i*dLongTableShardSize:]) = *(*[dLongTableShardSize]tableEntry)(e.dictLongTable[i*dLongTableShardSize:]) + e.longTableShardDirty[i] = false } } diff --git a/vendor/github.com/klauspost/compress/zstd/enc_fast.go b/vendor/github.com/klauspost/compress/zstd/enc_fast.go index f51ab529..315b1a8f 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_fast.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_fast.go @@ -43,7 +43,7 @@ func (e *fastEncoder) Encode(blk *blockEnc, src []byte) { ) // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { for i := range e.table[:] { e.table[i] = tableEntry{} @@ -304,13 +304,13 @@ func (e *fastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { minNonLiteralBlockSize = 1 + 1 + inputMargin ) if debugEncoder { - if len(src) > maxBlockSize { + if len(src) > maxCompressedBlockSize { panic("src too big") } } // Protect against e.cur wraparound. - if e.cur >= bufferReset { + if e.cur >= e.bufferReset { for i := range e.table[:] { e.table[i] = tableEntry{} } @@ -538,7 +538,7 @@ encodeLoop: println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) } // We do not store history, so we must offset e.cur to avoid false matches for next user. - if e.cur < bufferReset { + if e.cur < e.bufferReset { e.cur += int32(len(src)) } } @@ -555,11 +555,9 @@ func (e *fastEncoderDict) Encode(blk *blockEnc, src []byte) { return } // Protect against e.cur wraparound. - for e.cur >= bufferReset { + for e.cur >= e.bufferReset-int32(len(e.hist)) { if len(e.hist) == 0 { - for i := range e.table[:] { - e.table[i] = tableEntry{} - } + e.table = [tableSize]tableEntry{} e.cur = e.maxMatchOff break } @@ -871,7 +869,8 @@ func (e *fastEncoderDict) Reset(d *dict, singleBlock bool) { const shardCnt = tableShardCnt const shardSize = tableShardSize if e.allDirty || dirtyShardCnt > shardCnt*4/6 { - copy(e.table[:], e.dictTable) + //copy(e.table[:], e.dictTable) + e.table = *(*[tableSize]tableEntry)(e.dictTable) for i := range e.tableShardDirty { e.tableShardDirty[i] = false } @@ -883,7 +882,8 @@ func (e *fastEncoderDict) Reset(d *dict, singleBlock bool) { continue } - copy(e.table[i*shardSize:(i+1)*shardSize], e.dictTable[i*shardSize:(i+1)*shardSize]) + //copy(e.table[i*shardSize:(i+1)*shardSize], e.dictTable[i*shardSize:(i+1)*shardSize]) + *(*[shardSize]tableEntry)(e.table[i*shardSize:]) = *(*[shardSize]tableEntry)(e.dictTable[i*shardSize:]) e.tableShardDirty[i] = false } e.allDirty = false diff --git a/vendor/github.com/klauspost/compress/zstd/encoder.go b/vendor/github.com/klauspost/compress/zstd/encoder.go index e6b1d01c..65c6c36d 100644 --- a/vendor/github.com/klauspost/compress/zstd/encoder.go +++ b/vendor/github.com/klauspost/compress/zstd/encoder.go @@ -8,6 +8,7 @@ import ( "crypto/rand" "fmt" "io" + "math" rdebug "runtime/debug" "sync" @@ -528,8 +529,8 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte { // If a non-single block is needed the encoder will reset again. e.encoders <- enc }() - // Use single segments when above minimum window and below 1MB. - single := len(src) < 1<<20 && len(src) > MinWindowSize + // Use single segments when above minimum window and below window size. + single := len(src) <= e.o.windowSize && len(src) > MinWindowSize if e.o.single != nil { single = *e.o.single } @@ -639,3 +640,37 @@ func (e *Encoder) EncodeAll(src, dst []byte) []byte { } return dst } + +// MaxEncodedSize returns the expected maximum +// size of an encoded block or stream. +func (e *Encoder) MaxEncodedSize(size int) int { + frameHeader := 4 + 2 // magic + frame header & window descriptor + if e.o.dict != nil { + frameHeader += 4 + } + // Frame content size: + if size < 256 { + frameHeader++ + } else if size < 65536+256 { + frameHeader += 2 + } else if size < math.MaxInt32 { + frameHeader += 4 + } else { + frameHeader += 8 + } + // Final crc + if e.o.crc { + frameHeader += 4 + } + + // Max overhead is 3 bytes/block. + // There cannot be 0 blocks. + blocks := (size + e.o.blockSize) / e.o.blockSize + + // Combine, add padding. + maxSz := frameHeader + 3*blocks + size + if e.o.pad > 1 { + maxSz += calcSkippableFrame(int64(maxSz), int64(e.o.pad)) + } + return maxSz +} diff --git a/vendor/github.com/klauspost/compress/zstd/encoder_options.go b/vendor/github.com/klauspost/compress/zstd/encoder_options.go index 44d8dbd1..8e15be2f 100644 --- a/vendor/github.com/klauspost/compress/zstd/encoder_options.go +++ b/vendor/github.com/klauspost/compress/zstd/encoder_options.go @@ -3,6 +3,8 @@ package zstd import ( "errors" "fmt" + "math" + "math/bits" "runtime" "strings" ) @@ -47,22 +49,22 @@ func (o encoderOptions) encoder() encoder { switch o.level { case SpeedFastest: if o.dict != nil { - return &fastEncoderDict{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}}} + return &fastEncoderDict{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}} } - return &fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}} + return &fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}} case SpeedDefault: if o.dict != nil { - return &doubleFastEncoderDict{fastEncoderDict: fastEncoderDict{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}}}} + return &doubleFastEncoderDict{fastEncoderDict: fastEncoderDict{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}}} } - return &doubleFastEncoder{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}}} + return &doubleFastEncoder{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}} case SpeedBetterCompression: if o.dict != nil { - return &betterFastEncoderDict{betterFastEncoder: betterFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}}} + return &betterFastEncoderDict{betterFastEncoder: betterFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}} } - return &betterFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}} + return &betterFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}} case SpeedBestCompression: - return &bestFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), lowMem: o.lowMem}} + return &bestFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}} } panic("unknown compression level") } @@ -283,7 +285,7 @@ func WithNoEntropyCompression(b bool) EOption { // a decoder is allowed to reject a compressed frame which requests a memory size beyond decoder's authorized range. // For broader compatibility, decoders are recommended to support memory sizes of at least 8 MB. // This is only a recommendation, each decoder is free to support higher or lower limits, depending on local limitations. -// If this is not specified, block encodes will automatically choose this based on the input size. +// If this is not specified, block encodes will automatically choose this based on the input size and the window size. // This setting has no effect on streamed encodes. func WithSingleSegment(b bool) EOption { return func(o *encoderOptions) error { @@ -304,7 +306,13 @@ func WithLowerEncoderMem(b bool) EOption { } // WithEncoderDict allows to register a dictionary that will be used for the encode. +// +// The slice dict must be in the [dictionary format] produced by +// "zstd --train" from the Zstandard reference implementation. +// // The encoder *may* choose to use no dictionary instead for certain payloads. +// +// [dictionary format]: https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary-format func WithEncoderDict(dict []byte) EOption { return func(o *encoderOptions) error { d, err := loadDict(dict) @@ -315,3 +323,17 @@ func WithEncoderDict(dict []byte) EOption { return nil } } + +// WithEncoderDictRaw registers a dictionary that may be used by the encoder. +// +// The slice content may contain arbitrary data. It will be used as an initial +// history. +func WithEncoderDictRaw(id uint32, content []byte) EOption { + return func(o *encoderOptions) error { + if bits.UintSize > 32 && uint(len(content)) > dictMaxLength { + return fmt.Errorf("dictionary of size %d > 2GiB too large", len(content)) + } + o.dict = &dict{id: id, content: content, offsets: [3]int{1, 4, 8}} + return nil + } +} diff --git a/vendor/github.com/klauspost/compress/zstd/framedec.go b/vendor/github.com/klauspost/compress/zstd/framedec.go index fa0a633f..d8e8a05b 100644 --- a/vendor/github.com/klauspost/compress/zstd/framedec.go +++ b/vendor/github.com/klauspost/compress/zstd/framedec.go @@ -5,7 +5,7 @@ package zstd import ( - "bytes" + "encoding/binary" "encoding/hex" "errors" "io" @@ -29,7 +29,7 @@ type frameDec struct { FrameContentSize uint64 - DictionaryID *uint32 + DictionaryID uint32 HasCheckSum bool SingleSegment bool } @@ -43,9 +43,9 @@ const ( MaxWindowSize = 1 << 29 ) -var ( - frameMagic = []byte{0x28, 0xb5, 0x2f, 0xfd} - skippableFrameMagic = []byte{0x2a, 0x4d, 0x18} +const ( + frameMagic = "\x28\xb5\x2f\xfd" + skippableFrameMagic = "\x2a\x4d\x18" ) func newFrameDec(o decoderOptions) *frameDec { @@ -89,9 +89,9 @@ func (d *frameDec) reset(br byteBuffer) error { copy(signature[1:], b) } - if !bytes.Equal(signature[1:4], skippableFrameMagic) || signature[0]&0xf0 != 0x50 { + if string(signature[1:4]) != skippableFrameMagic || signature[0]&0xf0 != 0x50 { if debugDecoder { - println("Not skippable", hex.EncodeToString(signature[:]), hex.EncodeToString(skippableFrameMagic)) + println("Not skippable", hex.EncodeToString(signature[:]), hex.EncodeToString([]byte(skippableFrameMagic))) } // Break if not skippable frame. break @@ -106,7 +106,7 @@ func (d *frameDec) reset(br byteBuffer) error { } n := uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) println("Skipping frame with", n, "bytes.") - err = br.skipN(int(n)) + err = br.skipN(int64(n)) if err != nil { if debugDecoder { println("Reading discarded frame", err) @@ -114,9 +114,9 @@ func (d *frameDec) reset(br byteBuffer) error { return err } } - if !bytes.Equal(signature[:], frameMagic) { + if string(signature[:]) != frameMagic { if debugDecoder { - println("Got magic numbers: ", signature, "want:", frameMagic) + println("Got magic numbers: ", signature, "want:", []byte(frameMagic)) } return ErrMagicMismatch } @@ -155,7 +155,7 @@ func (d *frameDec) reset(br byteBuffer) error { // Read Dictionary_ID // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary_id - d.DictionaryID = nil + d.DictionaryID = 0 if size := fhd & 3; size != 0 { if size == 3 { size = 4 @@ -167,7 +167,7 @@ func (d *frameDec) reset(br byteBuffer) error { return err } var id uint32 - switch size { + switch len(b) { case 1: id = uint32(b[0]) case 2: @@ -178,11 +178,7 @@ func (d *frameDec) reset(br byteBuffer) error { if debugDecoder { println("Dict size", size, "ID:", id) } - if id > 0 { - // ID 0 means "sorry, no dictionary anyway". - // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary-format - d.DictionaryID = &id - } + d.DictionaryID = id } // Read Frame_Content_Size @@ -204,7 +200,7 @@ func (d *frameDec) reset(br byteBuffer) error { println("Reading Frame content", err) return err } - switch fcsSize { + switch len(b) { case 1: d.FrameContentSize = uint64(b[0]) case 2: @@ -231,20 +227,27 @@ func (d *frameDec) reset(br byteBuffer) error { d.crc.Reset() } + if d.WindowSize > d.o.maxWindowSize { + if debugDecoder { + printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) + } + return ErrWindowSizeExceeded + } + if d.WindowSize == 0 && d.SingleSegment { // We may not need window in this case. d.WindowSize = d.FrameContentSize if d.WindowSize < MinWindowSize { d.WindowSize = MinWindowSize } + if d.WindowSize > d.o.maxDecodedSize { + if debugDecoder { + printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) + } + return ErrDecoderSizeExceeded + } } - if d.WindowSize > uint64(d.o.maxWindowSize) { - if debugDecoder { - printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) - } - return ErrWindowSizeExceeded - } // The minimum Window_Size is 1 KB. if d.WindowSize < MinWindowSize { if debugDecoder { @@ -254,11 +257,16 @@ func (d *frameDec) reset(br byteBuffer) error { } d.history.windowSize = int(d.WindowSize) if !d.o.lowMem || d.history.windowSize < maxBlockSize { - // Alloc 2x window size if not low-mem, or very small window size. + // Alloc 2x window size if not low-mem, or window size below 2MB. d.history.allocFrameBuffer = d.history.windowSize * 2 } else { - // Alloc with one additional block - d.history.allocFrameBuffer = d.history.windowSize + maxBlockSize + if d.o.lowMem { + // Alloc with 1MB extra. + d.history.allocFrameBuffer = d.history.windowSize + maxBlockSize/2 + } else { + // Alloc with 2MB extra. + d.history.allocFrameBuffer = d.history.windowSize + maxBlockSize + } } if debugDecoder { @@ -293,7 +301,7 @@ func (d *frameDec) checkCRC() error { } // We can overwrite upper tmp now - want, err := d.rawInput.readSmall(4) + buf, err := d.rawInput.readSmall(4) if err != nil { println("CRC missing?", err) return err @@ -303,22 +311,17 @@ func (d *frameDec) checkCRC() error { return nil } - var tmp [4]byte - got := d.crc.Sum64() - // Flip to match file order. - tmp[0] = byte(got >> 0) - tmp[1] = byte(got >> 8) - tmp[2] = byte(got >> 16) - tmp[3] = byte(got >> 24) + want := binary.LittleEndian.Uint32(buf[:4]) + got := uint32(d.crc.Sum64()) - if !bytes.Equal(tmp[:], want) { + if got != want { if debugDecoder { - println("CRC Check Failed:", tmp[:], "!=", want) + printf("CRC check failed: got %08x, want %08x\n", got, want) } return ErrCRCMismatch } if debugDecoder { - println("CRC ok", tmp[:]) + printf("CRC ok %08x\n", got) } return nil } @@ -336,7 +339,7 @@ func (d *frameDec) consumeCRC() error { return nil } -// runDecoder will create a sync decoder that will decode a block of data. +// runDecoder will run the decoder for the remainder of the frame. func (d *frameDec) runDecoder(dst []byte, dec *blockDec) ([]byte, error) { saved := d.history.b @@ -346,12 +349,23 @@ func (d *frameDec) runDecoder(dst []byte, dec *blockDec) ([]byte, error) { // Store input length, so we only check new data. crcStart := len(dst) d.history.decoders.maxSyncLen = 0 + if d.o.limitToCap { + d.history.decoders.maxSyncLen = uint64(cap(dst) - len(dst)) + } if d.FrameContentSize != fcsUnknown { - d.history.decoders.maxSyncLen = d.FrameContentSize + uint64(len(dst)) + if !d.o.limitToCap || d.FrameContentSize+uint64(len(dst)) < d.history.decoders.maxSyncLen { + d.history.decoders.maxSyncLen = d.FrameContentSize + uint64(len(dst)) + } if d.history.decoders.maxSyncLen > d.o.maxDecodedSize { + if debugDecoder { + println("maxSyncLen:", d.history.decoders.maxSyncLen, "> maxDecodedSize:", d.o.maxDecodedSize) + } return dst, ErrDecoderSizeExceeded } - if uint64(cap(dst)) < d.history.decoders.maxSyncLen { + if debugDecoder { + println("maxSyncLen:", d.history.decoders.maxSyncLen) + } + if !d.o.limitToCap && uint64(cap(dst)) < d.history.decoders.maxSyncLen { // Alloc for output dst2 := make([]byte, len(dst), d.history.decoders.maxSyncLen+compressedBlockOverAlloc) copy(dst2, dst) @@ -371,7 +385,13 @@ func (d *frameDec) runDecoder(dst []byte, dec *blockDec) ([]byte, error) { if err != nil { break } - if uint64(len(d.history.b)) > d.o.maxDecodedSize { + if uint64(len(d.history.b)-crcStart) > d.o.maxDecodedSize { + println("runDecoder: maxDecodedSize exceeded", uint64(len(d.history.b)-crcStart), ">", d.o.maxDecodedSize) + err = ErrDecoderSizeExceeded + break + } + if d.o.limitToCap && len(d.history.b) > cap(dst) { + println("runDecoder: cap exceeded", uint64(len(d.history.b)), ">", cap(dst)) err = ErrDecoderSizeExceeded break } diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go index e74df436..d04a829b 100644 --- a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go @@ -21,7 +21,8 @@ type buildDtableAsmContext struct { // buildDtable_asm is an x86 assembly implementation of fseDecoder.buildDtable. // Function returns non-zero exit code on error. -// go:noescape +// +//go:noescape func buildDtable_asm(s *fseDecoder, ctx *buildDtableAsmContext) int // please keep in sync with _generate/gen_fse.go @@ -34,8 +35,8 @@ const ( // buildDtable will build the decoding table. func (s *fseDecoder) buildDtable() error { ctx := buildDtableAsmContext{ - stateTable: (*uint16)(&s.stateTable[0]), - norm: (*int16)(&s.norm[0]), + stateTable: &s.stateTable[0], + norm: &s.norm[0], dt: (*uint64)(&s.dt[0]), } code := buildDtable_asm(s, &ctx) diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s index da32b442..bcde3986 100644 --- a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s @@ -1,7 +1,6 @@ // Code generated by command: go run gen_fse.go -out ../fse_decoder_amd64.s -pkg=zstd. DO NOT EDIT. //go:build !appengine && !noasm && gc && !noasm -// +build !appengine,!noasm,gc,!noasm // func buildDtable_asm(s *fseDecoder, ctx *buildDtableAsmContext) int TEXT ·buildDtable_asm(SB), $0-24 diff --git a/vendor/github.com/klauspost/compress/zstd/history.go b/vendor/github.com/klauspost/compress/zstd/history.go index 28b40153..09164856 100644 --- a/vendor/github.com/klauspost/compress/zstd/history.go +++ b/vendor/github.com/klauspost/compress/zstd/history.go @@ -37,26 +37,23 @@ func (h *history) reset() { h.ignoreBuffer = 0 h.error = false h.recentOffsets = [3]int{1, 4, 8} - if f := h.decoders.litLengths.fse; f != nil && !f.preDefined { - fseDecoderPool.Put(f) - } - if f := h.decoders.offsets.fse; f != nil && !f.preDefined { - fseDecoderPool.Put(f) - } - if f := h.decoders.matchLengths.fse; f != nil && !f.preDefined { - fseDecoderPool.Put(f) - } + h.decoders.freeDecoders() h.decoders = sequenceDecs{br: h.decoders.br} - if h.huffTree != nil { - if h.dict == nil || h.dict.litEnc != h.huffTree { - huffDecoderPool.Put(h.huffTree) - } - } + h.freeHuffDecoder() h.huffTree = nil h.dict = nil //printf("history created: %+v (l: %d, c: %d)", *h, len(h.b), cap(h.b)) } +func (h *history) freeHuffDecoder() { + if h.huffTree != nil { + if h.dict == nil || h.dict.litEnc != h.huffTree { + huffDecoderPool.Put(h.huffTree) + h.huffTree = nil + } + } +} + func (h *history) setDict(dict *dict) { if dict == nil { return diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md index 69aa3bb5..777290d4 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md @@ -2,12 +2,7 @@ VENDORED: Go to [github.com/cespare/xxhash](https://github.com/cespare/xxhash) for original package. - -[![GoDoc](https://godoc.org/github.com/cespare/xxhash?status.svg)](https://godoc.org/github.com/cespare/xxhash) -[![Build Status](https://travis-ci.org/cespare/xxhash.svg?branch=master)](https://travis-ci.org/cespare/xxhash) - -xxhash is a Go implementation of the 64-bit -[xxHash](http://cyan4973.github.io/xxHash/) algorithm, XXH64. This is a +xxhash is a Go implementation of the 64-bit [xxHash] algorithm, XXH64. This is a high-quality hashing algorithm that is much faster than anything in the Go standard library. @@ -28,31 +23,49 @@ func (*Digest) WriteString(string) (int, error) func (*Digest) Sum64() uint64 ``` -This implementation provides a fast pure-Go implementation and an even faster -assembly implementation for amd64. +The package is written with optimized pure Go and also contains even faster +assembly implementations for amd64 and arm64. If desired, the `purego` build tag +opts into using the Go code even on those architectures. + +[xxHash]: http://cyan4973.github.io/xxHash/ + +## Compatibility + +This package is in a module and the latest code is in version 2 of the module. +You need a version of Go with at least "minimal module compatibility" to use +github.com/cespare/xxhash/v2: + +* 1.9.7+ for Go 1.9 +* 1.10.3+ for Go 1.10 +* Go 1.11 or later + +I recommend using the latest release of Go. ## Benchmarks Here are some quick benchmarks comparing the pure-Go and assembly implementations of Sum64. -| input size | purego | asm | -| --- | --- | --- | -| 5 B | 979.66 MB/s | 1291.17 MB/s | -| 100 B | 7475.26 MB/s | 7973.40 MB/s | -| 4 KB | 17573.46 MB/s | 17602.65 MB/s | -| 10 MB | 17131.46 MB/s | 17142.16 MB/s | +| input size | purego | asm | +| ---------- | --------- | --------- | +| 4 B | 1.3 GB/s | 1.2 GB/s | +| 16 B | 2.9 GB/s | 3.5 GB/s | +| 100 B | 6.9 GB/s | 8.1 GB/s | +| 4 KB | 11.7 GB/s | 16.7 GB/s | +| 10 MB | 12.0 GB/s | 17.3 GB/s | -These numbers were generated on Ubuntu 18.04 with an Intel i7-8700K CPU using -the following commands under Go 1.11.2: +These numbers were generated on Ubuntu 20.04 with an Intel Xeon Platinum 8252C +CPU using the following commands under Go 1.19.2: ``` -$ go test -tags purego -benchtime 10s -bench '/xxhash,direct,bytes' -$ go test -benchtime 10s -bench '/xxhash,direct,bytes' +benchstat <(go test -tags purego -benchtime 500ms -count 15 -bench 'Sum64$') +benchstat <(go test -benchtime 500ms -count 15 -bench 'Sum64$') ``` ## Projects using this package - [InfluxDB](https://github.com/influxdata/influxdb) - [Prometheus](https://github.com/prometheus/prometheus) +- [VictoriaMetrics](https://github.com/VictoriaMetrics/VictoriaMetrics) - [FreeCache](https://github.com/coocood/freecache) +- [FastCache](https://github.com/VictoriaMetrics/fastcache) diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go index 2c112a0a..fc40c820 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go @@ -18,19 +18,11 @@ const ( prime5 uint64 = 2870177450012600261 ) -// NOTE(caleb): I'm using both consts and vars of the primes. Using consts where -// possible in the Go code is worth a small (but measurable) performance boost -// by avoiding some MOVQs. Vars are needed for the asm and also are useful for -// convenience in the Go code in a few places where we need to intentionally -// avoid constant arithmetic (e.g., v1 := prime1 + prime2 fails because the -// result overflows a uint64). -var ( - prime1v = prime1 - prime2v = prime2 - prime3v = prime3 - prime4v = prime4 - prime5v = prime5 -) +// Store the primes in an array as well. +// +// The consts are used when possible in Go code to avoid MOVs but we need a +// contiguous array of the assembly code. +var primes = [...]uint64{prime1, prime2, prime3, prime4, prime5} // Digest implements hash.Hash64. type Digest struct { @@ -52,10 +44,10 @@ func New() *Digest { // Reset clears the Digest's state so that it can be reused. func (d *Digest) Reset() { - d.v1 = prime1v + prime2 + d.v1 = primes[0] + prime2 d.v2 = prime2 d.v3 = 0 - d.v4 = -prime1v + d.v4 = -primes[0] d.total = 0 d.n = 0 } @@ -71,21 +63,23 @@ func (d *Digest) Write(b []byte) (n int, err error) { n = len(b) d.total += uint64(n) + memleft := d.mem[d.n&(len(d.mem)-1):] + if d.n+n < 32 { // This new data doesn't even fill the current block. - copy(d.mem[d.n:], b) + copy(memleft, b) d.n += n return } if d.n > 0 { // Finish off the partial block. - copy(d.mem[d.n:], b) + c := copy(memleft, b) d.v1 = round(d.v1, u64(d.mem[0:8])) d.v2 = round(d.v2, u64(d.mem[8:16])) d.v3 = round(d.v3, u64(d.mem[16:24])) d.v4 = round(d.v4, u64(d.mem[24:32])) - b = b[32-d.n:] + b = b[c:] d.n = 0 } @@ -135,21 +129,20 @@ func (d *Digest) Sum64() uint64 { h += d.total - i, end := 0, d.n - for ; i+8 <= end; i += 8 { - k1 := round(0, u64(d.mem[i:i+8])) + b := d.mem[:d.n&(len(d.mem)-1)] + for ; len(b) >= 8; b = b[8:] { + k1 := round(0, u64(b[:8])) h ^= k1 h = rol27(h)*prime1 + prime4 } - if i+4 <= end { - h ^= uint64(u32(d.mem[i:i+4])) * prime1 + if len(b) >= 4 { + h ^= uint64(u32(b[:4])) * prime1 h = rol23(h)*prime2 + prime3 - i += 4 + b = b[4:] } - for i < end { - h ^= uint64(d.mem[i]) * prime5 + for ; len(b) > 0; b = b[1:] { + h ^= uint64(b[0]) * prime5 h = rol11(h) * prime1 - i++ } h ^= h >> 33 diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s index cea17856..ddb63aa9 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s @@ -1,3 +1,4 @@ +//go:build !appengine && gc && !purego && !noasm // +build !appengine // +build gc // +build !purego @@ -5,212 +6,205 @@ #include "textflag.h" -// Register allocation: -// AX h -// SI pointer to advance through b -// DX n -// BX loop end -// R8 v1, k1 -// R9 v2 -// R10 v3 -// R11 v4 -// R12 tmp -// R13 prime1v -// R14 prime2v -// DI prime4v +// Registers: +#define h AX +#define d AX +#define p SI // pointer to advance through b +#define n DX +#define end BX // loop end +#define v1 R8 +#define v2 R9 +#define v3 R10 +#define v4 R11 +#define x R12 +#define prime1 R13 +#define prime2 R14 +#define prime4 DI -// round reads from and advances the buffer pointer in SI. -// It assumes that R13 has prime1v and R14 has prime2v. -#define round(r) \ - MOVQ (SI), R12 \ - ADDQ $8, SI \ - IMULQ R14, R12 \ - ADDQ R12, r \ - ROLQ $31, r \ - IMULQ R13, r +#define round(acc, x) \ + IMULQ prime2, x \ + ADDQ x, acc \ + ROLQ $31, acc \ + IMULQ prime1, acc -// mergeRound applies a merge round on the two registers acc and val. -// It assumes that R13 has prime1v, R14 has prime2v, and DI has prime4v. -#define mergeRound(acc, val) \ - IMULQ R14, val \ - ROLQ $31, val \ - IMULQ R13, val \ - XORQ val, acc \ - IMULQ R13, acc \ - ADDQ DI, acc +// round0 performs the operation x = round(0, x). +#define round0(x) \ + IMULQ prime2, x \ + ROLQ $31, x \ + IMULQ prime1, x + +// mergeRound applies a merge round on the two registers acc and x. +// It assumes that prime1, prime2, and prime4 have been loaded. +#define mergeRound(acc, x) \ + round0(x) \ + XORQ x, acc \ + IMULQ prime1, acc \ + ADDQ prime4, acc + +// blockLoop processes as many 32-byte blocks as possible, +// updating v1, v2, v3, and v4. It assumes that there is at least one block +// to process. +#define blockLoop() \ +loop: \ + MOVQ +0(p), x \ + round(v1, x) \ + MOVQ +8(p), x \ + round(v2, x) \ + MOVQ +16(p), x \ + round(v3, x) \ + MOVQ +24(p), x \ + round(v4, x) \ + ADDQ $32, p \ + CMPQ p, end \ + JLE loop // func Sum64(b []byte) uint64 -TEXT ·Sum64(SB), NOSPLIT, $0-32 +TEXT ·Sum64(SB), NOSPLIT|NOFRAME, $0-32 // Load fixed primes. - MOVQ ·prime1v(SB), R13 - MOVQ ·prime2v(SB), R14 - MOVQ ·prime4v(SB), DI + MOVQ ·primes+0(SB), prime1 + MOVQ ·primes+8(SB), prime2 + MOVQ ·primes+24(SB), prime4 // Load slice. - MOVQ b_base+0(FP), SI - MOVQ b_len+8(FP), DX - LEAQ (SI)(DX*1), BX + MOVQ b_base+0(FP), p + MOVQ b_len+8(FP), n + LEAQ (p)(n*1), end // The first loop limit will be len(b)-32. - SUBQ $32, BX + SUBQ $32, end // Check whether we have at least one block. - CMPQ DX, $32 + CMPQ n, $32 JLT noBlocks // Set up initial state (v1, v2, v3, v4). - MOVQ R13, R8 - ADDQ R14, R8 - MOVQ R14, R9 - XORQ R10, R10 - XORQ R11, R11 - SUBQ R13, R11 + MOVQ prime1, v1 + ADDQ prime2, v1 + MOVQ prime2, v2 + XORQ v3, v3 + XORQ v4, v4 + SUBQ prime1, v4 - // Loop until SI > BX. -blockLoop: - round(R8) - round(R9) - round(R10) - round(R11) + blockLoop() - CMPQ SI, BX - JLE blockLoop + MOVQ v1, h + ROLQ $1, h + MOVQ v2, x + ROLQ $7, x + ADDQ x, h + MOVQ v3, x + ROLQ $12, x + ADDQ x, h + MOVQ v4, x + ROLQ $18, x + ADDQ x, h - MOVQ R8, AX - ROLQ $1, AX - MOVQ R9, R12 - ROLQ $7, R12 - ADDQ R12, AX - MOVQ R10, R12 - ROLQ $12, R12 - ADDQ R12, AX - MOVQ R11, R12 - ROLQ $18, R12 - ADDQ R12, AX - - mergeRound(AX, R8) - mergeRound(AX, R9) - mergeRound(AX, R10) - mergeRound(AX, R11) + mergeRound(h, v1) + mergeRound(h, v2) + mergeRound(h, v3) + mergeRound(h, v4) JMP afterBlocks noBlocks: - MOVQ ·prime5v(SB), AX + MOVQ ·primes+32(SB), h afterBlocks: - ADDQ DX, AX + ADDQ n, h - // Right now BX has len(b)-32, and we want to loop until SI > len(b)-8. - ADDQ $24, BX + ADDQ $24, end + CMPQ p, end + JG try4 - CMPQ SI, BX - JG fourByte +loop8: + MOVQ (p), x + ADDQ $8, p + round0(x) + XORQ x, h + ROLQ $27, h + IMULQ prime1, h + ADDQ prime4, h -wordLoop: - // Calculate k1. - MOVQ (SI), R8 - ADDQ $8, SI - IMULQ R14, R8 - ROLQ $31, R8 - IMULQ R13, R8 + CMPQ p, end + JLE loop8 - XORQ R8, AX - ROLQ $27, AX - IMULQ R13, AX - ADDQ DI, AX +try4: + ADDQ $4, end + CMPQ p, end + JG try1 - CMPQ SI, BX - JLE wordLoop + MOVL (p), x + ADDQ $4, p + IMULQ prime1, x + XORQ x, h -fourByte: - ADDQ $4, BX - CMPQ SI, BX - JG singles + ROLQ $23, h + IMULQ prime2, h + ADDQ ·primes+16(SB), h - MOVL (SI), R8 - ADDQ $4, SI - IMULQ R13, R8 - XORQ R8, AX - - ROLQ $23, AX - IMULQ R14, AX - ADDQ ·prime3v(SB), AX - -singles: - ADDQ $4, BX - CMPQ SI, BX +try1: + ADDQ $4, end + CMPQ p, end JGE finalize -singlesLoop: - MOVBQZX (SI), R12 - ADDQ $1, SI - IMULQ ·prime5v(SB), R12 - XORQ R12, AX +loop1: + MOVBQZX (p), x + ADDQ $1, p + IMULQ ·primes+32(SB), x + XORQ x, h + ROLQ $11, h + IMULQ prime1, h - ROLQ $11, AX - IMULQ R13, AX - - CMPQ SI, BX - JL singlesLoop + CMPQ p, end + JL loop1 finalize: - MOVQ AX, R12 - SHRQ $33, R12 - XORQ R12, AX - IMULQ R14, AX - MOVQ AX, R12 - SHRQ $29, R12 - XORQ R12, AX - IMULQ ·prime3v(SB), AX - MOVQ AX, R12 - SHRQ $32, R12 - XORQ R12, AX + MOVQ h, x + SHRQ $33, x + XORQ x, h + IMULQ prime2, h + MOVQ h, x + SHRQ $29, x + XORQ x, h + IMULQ ·primes+16(SB), h + MOVQ h, x + SHRQ $32, x + XORQ x, h - MOVQ AX, ret+24(FP) + MOVQ h, ret+24(FP) RET -// writeBlocks uses the same registers as above except that it uses AX to store -// the d pointer. - // func writeBlocks(d *Digest, b []byte) int -TEXT ·writeBlocks(SB), NOSPLIT, $0-40 +TEXT ·writeBlocks(SB), NOSPLIT|NOFRAME, $0-40 // Load fixed primes needed for round. - MOVQ ·prime1v(SB), R13 - MOVQ ·prime2v(SB), R14 + MOVQ ·primes+0(SB), prime1 + MOVQ ·primes+8(SB), prime2 // Load slice. - MOVQ b_base+8(FP), SI - MOVQ b_len+16(FP), DX - LEAQ (SI)(DX*1), BX - SUBQ $32, BX + MOVQ b_base+8(FP), p + MOVQ b_len+16(FP), n + LEAQ (p)(n*1), end + SUBQ $32, end // Load vN from d. - MOVQ d+0(FP), AX - MOVQ 0(AX), R8 // v1 - MOVQ 8(AX), R9 // v2 - MOVQ 16(AX), R10 // v3 - MOVQ 24(AX), R11 // v4 + MOVQ s+0(FP), d + MOVQ 0(d), v1 + MOVQ 8(d), v2 + MOVQ 16(d), v3 + MOVQ 24(d), v4 // We don't need to check the loop condition here; this function is // always called with at least one block of data to process. -blockLoop: - round(R8) - round(R9) - round(R10) - round(R11) - - CMPQ SI, BX - JLE blockLoop + blockLoop() // Copy vN back to d. - MOVQ R8, 0(AX) - MOVQ R9, 8(AX) - MOVQ R10, 16(AX) - MOVQ R11, 24(AX) + MOVQ v1, 0(d) + MOVQ v2, 8(d) + MOVQ v3, 16(d) + MOVQ v4, 24(d) - // The number of bytes written is SI minus the old base pointer. - SUBQ b_base+8(FP), SI - MOVQ SI, ret+32(FP) + // The number of bytes written is p minus the old base pointer. + SUBQ b_base+8(FP), p + MOVQ p, ret+32(FP) RET diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s index 4d64a17d..17901e08 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s @@ -1,13 +1,17 @@ -// +build gc,!purego,!noasm +//go:build !appengine && gc && !purego && !noasm +// +build !appengine +// +build gc +// +build !purego +// +build !noasm #include "textflag.h" -// Register allocation. +// Registers: #define digest R1 -#define h R2 // Return value. -#define p R3 // Input pointer. -#define len R4 -#define nblocks R5 // len / 32. +#define h R2 // return value +#define p R3 // input pointer +#define n R4 // input length +#define nblocks R5 // n / 32 #define prime1 R7 #define prime2 R8 #define prime3 R9 @@ -25,60 +29,52 @@ #define round(acc, x) \ MADD prime2, acc, x, acc \ ROR $64-31, acc \ - MUL prime1, acc \ + MUL prime1, acc -// x = round(0, x). +// round0 performs the operation x = round(0, x). #define round0(x) \ MUL prime2, x \ ROR $64-31, x \ - MUL prime1, x \ + MUL prime1, x -#define mergeRound(x) \ - round0(x) \ - EOR x, h \ - MADD h, prime4, prime1, h \ +#define mergeRound(acc, x) \ + round0(x) \ + EOR x, acc \ + MADD acc, prime4, prime1, acc -// Update v[1-4] with 32-byte blocks. Assumes len >= 32. -#define blocksLoop() \ - LSR $5, len, nblocks \ - PCALIGN $16 \ - loop: \ - LDP.P 32(p), (x1, x2) \ - round(v1, x1) \ - LDP -16(p), (x3, x4) \ - round(v2, x2) \ - SUB $1, nblocks \ - round(v3, x3) \ - round(v4, x4) \ - CBNZ nblocks, loop \ - -// The primes are repeated here to ensure that they're stored -// in a contiguous array, so we can load them with LDP. -DATA primes<> +0(SB)/8, $11400714785074694791 -DATA primes<> +8(SB)/8, $14029467366897019727 -DATA primes<>+16(SB)/8, $1609587929392839161 -DATA primes<>+24(SB)/8, $9650029242287828579 -DATA primes<>+32(SB)/8, $2870177450012600261 -GLOBL primes<>(SB), NOPTR+RODATA, $40 +// blockLoop processes as many 32-byte blocks as possible, +// updating v1, v2, v3, and v4. It assumes that n >= 32. +#define blockLoop() \ + LSR $5, n, nblocks \ + PCALIGN $16 \ + loop: \ + LDP.P 16(p), (x1, x2) \ + LDP.P 16(p), (x3, x4) \ + round(v1, x1) \ + round(v2, x2) \ + round(v3, x3) \ + round(v4, x4) \ + SUB $1, nblocks \ + CBNZ nblocks, loop // func Sum64(b []byte) uint64 -TEXT ·Sum64(SB), NOFRAME+NOSPLIT, $0-32 - LDP b_base+0(FP), (p, len) +TEXT ·Sum64(SB), NOSPLIT|NOFRAME, $0-32 + LDP b_base+0(FP), (p, n) - LDP primes<> +0(SB), (prime1, prime2) - LDP primes<>+16(SB), (prime3, prime4) - MOVD primes<>+32(SB), prime5 + LDP ·primes+0(SB), (prime1, prime2) + LDP ·primes+16(SB), (prime3, prime4) + MOVD ·primes+32(SB), prime5 - CMP $32, len - CSEL LO, prime5, ZR, h // if len < 32 { h = prime5 } else { h = 0 } - BLO afterLoop + CMP $32, n + CSEL LT, prime5, ZR, h // if n < 32 { h = prime5 } else { h = 0 } + BLT afterLoop ADD prime1, prime2, v1 MOVD prime2, v2 MOVD $0, v3 NEG prime1, v4 - blocksLoop() + blockLoop() ROR $64-1, v1, x1 ROR $64-7, v2, x2 @@ -88,71 +84,75 @@ TEXT ·Sum64(SB), NOFRAME+NOSPLIT, $0-32 ADD x3, x4 ADD x2, x4, h - mergeRound(v1) - mergeRound(v2) - mergeRound(v3) - mergeRound(v4) + mergeRound(h, v1) + mergeRound(h, v2) + mergeRound(h, v3) + mergeRound(h, v4) afterLoop: - ADD len, h + ADD n, h - TBZ $4, len, try8 + TBZ $4, n, try8 LDP.P 16(p), (x1, x2) round0(x1) + + // NOTE: here and below, sequencing the EOR after the ROR (using a + // rotated register) is worth a small but measurable speedup for small + // inputs. ROR $64-27, h EOR x1 @> 64-27, h, h MADD h, prime4, prime1, h round0(x2) ROR $64-27, h - EOR x2 @> 64-27, h + EOR x2 @> 64-27, h, h MADD h, prime4, prime1, h try8: - TBZ $3, len, try4 + TBZ $3, n, try4 MOVD.P 8(p), x1 round0(x1) ROR $64-27, h - EOR x1 @> 64-27, h + EOR x1 @> 64-27, h, h MADD h, prime4, prime1, h try4: - TBZ $2, len, try2 + TBZ $2, n, try2 MOVWU.P 4(p), x2 MUL prime1, x2 ROR $64-23, h - EOR x2 @> 64-23, h + EOR x2 @> 64-23, h, h MADD h, prime3, prime2, h try2: - TBZ $1, len, try1 + TBZ $1, n, try1 MOVHU.P 2(p), x3 AND $255, x3, x1 LSR $8, x3, x2 MUL prime5, x1 ROR $64-11, h - EOR x1 @> 64-11, h + EOR x1 @> 64-11, h, h MUL prime1, h MUL prime5, x2 ROR $64-11, h - EOR x2 @> 64-11, h + EOR x2 @> 64-11, h, h MUL prime1, h try1: - TBZ $0, len, end + TBZ $0, n, finalize MOVBU (p), x4 MUL prime5, x4 ROR $64-11, h - EOR x4 @> 64-11, h + EOR x4 @> 64-11, h, h MUL prime1, h -end: +finalize: EOR h >> 33, h MUL prime2, h EOR h >> 29, h @@ -163,24 +163,22 @@ end: RET // func writeBlocks(d *Digest, b []byte) int -// -// Assumes len(b) >= 32. -TEXT ·writeBlocks(SB), NOFRAME+NOSPLIT, $0-40 - LDP primes<>(SB), (prime1, prime2) +TEXT ·writeBlocks(SB), NOSPLIT|NOFRAME, $0-40 + LDP ·primes+0(SB), (prime1, prime2) // Load state. Assume v[1-4] are stored contiguously. MOVD d+0(FP), digest LDP 0(digest), (v1, v2) LDP 16(digest), (v3, v4) - LDP b_base+8(FP), (p, len) + LDP b_base+8(FP), (p, n) - blocksLoop() + blockLoop() // Store updated state. STP (v1, v2), 0(digest) STP (v3, v4), 16(digest) - BIC $31, len - MOVD len, ret+32(FP) + BIC $31, n + MOVD n, ret+32(FP) RET diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go index 1a1fac9c..d4221edf 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go @@ -13,4 +13,4 @@ package xxhash func Sum64(b []byte) uint64 //go:noescape -func writeBlocks(d *Digest, b []byte) int +func writeBlocks(s *Digest, b []byte) int diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go index 209cb4a9..0be16cef 100644 --- a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go @@ -15,10 +15,10 @@ func Sum64(b []byte) uint64 { var h uint64 if n >= 32 { - v1 := prime1v + prime2 + v1 := primes[0] + prime2 v2 := prime2 v3 := uint64(0) - v4 := -prime1v + v4 := -primes[0] for len(b) >= 32 { v1 = round(v1, u64(b[0:8:len(b)])) v2 = round(v2, u64(b[8:16:len(b)])) @@ -37,19 +37,18 @@ func Sum64(b []byte) uint64 { h += uint64(n) - i, end := 0, len(b) - for ; i+8 <= end; i += 8 { - k1 := round(0, u64(b[i:i+8:len(b)])) + for ; len(b) >= 8; b = b[8:] { + k1 := round(0, u64(b[:8])) h ^= k1 h = rol27(h)*prime1 + prime4 } - if i+4 <= end { - h ^= uint64(u32(b[i:i+4:len(b)])) * prime1 + if len(b) >= 4 { + h ^= uint64(u32(b[:4])) * prime1 h = rol23(h)*prime2 + prime3 - i += 4 + b = b[4:] } - for ; i < end; i++ { - h ^= uint64(b[i]) * prime5 + for ; len(b) > 0; b = b[1:] { + h ^= uint64(b[0]) * prime5 h = rol11(h) * prime1 } diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec.go b/vendor/github.com/klauspost/compress/zstd/seqdec.go index df044720..f833d154 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec.go +++ b/vendor/github.com/klauspost/compress/zstd/seqdec.go @@ -99,6 +99,21 @@ func (s *sequenceDecs) initialize(br *bitReader, hist *history, out []byte) erro return nil } +func (s *sequenceDecs) freeDecoders() { + if f := s.litLengths.fse; f != nil && !f.preDefined { + fseDecoderPool.Put(f) + s.litLengths.fse = nil + } + if f := s.offsets.fse; f != nil && !f.preDefined { + fseDecoderPool.Put(f) + s.offsets.fse = nil + } + if f := s.matchLengths.fse; f != nil && !f.preDefined { + fseDecoderPool.Put(f) + s.matchLengths.fse = nil + } +} + // execute will execute the decoded sequence with the provided history. // The sequence must be evaluated before being sent. func (s *sequenceDecs) execute(seqs []seqVals, hist []byte) error { @@ -299,7 +314,10 @@ func (s *sequenceDecs) decodeSync(hist []byte) error { } size := ll + ml + len(out) if size-startSize > maxBlockSize { - return fmt.Errorf("output (%d) bigger than max block size (%d)", size-startSize, maxBlockSize) + if size-startSize == 424242 { + panic("here") + } + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) } if size > cap(out) { // Not enough size, which can happen under high volume block streaming conditions @@ -411,7 +429,7 @@ func (s *sequenceDecs) decodeSync(hist []byte) error { // Check if space for literals if size := len(s.literals) + len(s.out) - startSize; size > maxBlockSize { - return fmt.Errorf("output (%d) bigger than max block size (%d)", size, maxBlockSize) + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) } // Add final literals diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go index 847b322a..191384ad 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go @@ -32,18 +32,22 @@ type decodeSyncAsmContext struct { // sequenceDecs_decodeSync_amd64 implements the main loop of sequenceDecs.decodeSync in x86 asm. // // Please refer to seqdec_generic.go for the reference implementation. +// //go:noescape func sequenceDecs_decodeSync_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int // sequenceDecs_decodeSync_bmi2 implements the main loop of sequenceDecs.decodeSync in x86 asm with BMI2 extensions. +// //go:noescape func sequenceDecs_decodeSync_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int // sequenceDecs_decodeSync_safe_amd64 does the same as above, but does not write more than output buffer. +// //go:noescape func sequenceDecs_decodeSync_safe_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int // sequenceDecs_decodeSync_safe_bmi2 does the same as above, but does not write more than output buffer. +// //go:noescape func sequenceDecs_decodeSync_safe_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int @@ -55,16 +59,22 @@ func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSize { return false, nil } - useSafe := false - if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSizeAlloc { - useSafe = true - } - if s.maxSyncLen > 0 && cap(s.out)-len(s.out)-compressedBlockOverAlloc < int(s.maxSyncLen) { - useSafe = true - } - if cap(s.literals) < len(s.literals)+compressedBlockOverAlloc { - useSafe = true - } + + // FIXME: Using unsafe memory copies leads to rare, random crashes + // with fuzz testing. It is therefore disabled for now. + const useSafe = true + /* + useSafe := false + if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSizeAlloc { + useSafe = true + } + if s.maxSyncLen > 0 && cap(s.out)-len(s.out)-compressedBlockOverAlloc < int(s.maxSyncLen) { + useSafe = true + } + if cap(s.literals) < len(s.literals)+compressedBlockOverAlloc { + useSafe = true + } + */ br := s.br @@ -129,7 +139,7 @@ func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { if debugDecoder { println("msl:", s.maxSyncLen, "cap", cap(s.out), "bef:", startSize, "sz:", size-startSize, "mbs:", maxBlockSize, "outsz:", cap(s.out)-startSize) } - return true, fmt.Errorf("output (%d) bigger than max block size (%d)", size-startSize, maxBlockSize) + return true, fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) default: return true, fmt.Errorf("sequenceDecs_decode returned erronous code %d", errCode) @@ -137,7 +147,8 @@ func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { s.seqSize += ctx.litRemain if s.seqSize > maxBlockSize { - return true, fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + return true, fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } err := br.close() if err != nil { @@ -195,20 +206,24 @@ const errorNotEnoughSpace = 5 // sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm. // // Please refer to seqdec_generic.go for the reference implementation. +// //go:noescape func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm. // // Please refer to seqdec_generic.go for the reference implementation. +// //go:noescape func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm with BMI2 extensions. +// //go:noescape func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm with BMI2 extensions. +// //go:noescape func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int @@ -275,7 +290,7 @@ func (s *sequenceDecs) decode(seqs []seqVals) error { s.seqSize += ctx.litRemain if s.seqSize > maxBlockSize { - return fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) } err := br.close() if err != nil { @@ -302,10 +317,12 @@ type executeAsmContext struct { // Returns false if a match offset is too big. // // Please refer to seqdec_generic.go for the reference implementation. +// //go:noescape func sequenceDecs_executeSimple_amd64(ctx *executeAsmContext) bool // Same as above, but with safe memcopies +// //go:noescape func sequenceDecs_executeSimple_safe_amd64(ctx *executeAsmContext) bool diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s index 71e64e06..b94993a0 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s @@ -1,7 +1,6 @@ // Code generated by command: go run gen.go -out ../seqdec_amd64.s -pkg=zstd. DO NOT EDIT. //go:build !appengine && !noasm && gc && !noasm -// +build !appengine,!noasm,gc,!noasm // func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // Requires: CMOV @@ -52,34 +51,46 @@ sequenceDecs_decode_amd64_fill_byte_by_byte: sequenceDecs_decode_amd64_fill_end: // Update offset - MOVQ R9, AX - MOVQ BX, CX - MOVQ DX, R15 - SHLQ CL, R15 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R15 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R15 - ADDQ R15, AX - MOVQ AX, 16(R10) + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_of_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_of_update_zero: + MOVQ AX, 16(R10) // Update match length - MOVQ R8, AX - MOVQ BX, CX - MOVQ DX, R15 - SHLQ CL, R15 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R15 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R15 - ADDQ R15, AX - MOVQ AX, 8(R10) + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_ml_update_zero: + MOVQ AX, 8(R10) // Fill bitreader to have enough for the remaining CMPQ SI, $0x08 @@ -107,19 +118,25 @@ sequenceDecs_decode_amd64_fill_2_byte_by_byte: sequenceDecs_decode_amd64_fill_2_end: // Update literal length - MOVQ DI, AX - MOVQ BX, CX - MOVQ DX, R15 - SHLQ CL, R15 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R15 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R15 - ADDQ R15, AX - MOVQ AX, (R10) + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_ll_update_zero: + MOVQ AX, (R10) // Fill bitreader for state updates MOVQ R14, (SP) @@ -198,7 +215,7 @@ sequenceDecs_decode_amd64_skip_update: MOVQ R12, R13 MOVQ R11, R12 MOVQ CX, R11 - JMP sequenceDecs_decode_amd64_adjust_end + JMP sequenceDecs_decode_amd64_after_adjust sequenceDecs_decode_amd64_adjust_offsetB_1_or_0: CMPQ (R10), $0x00000000 @@ -210,7 +227,7 @@ sequenceDecs_decode_amd64_adjust_offset_maybezero: TESTQ CX, CX JNZ sequenceDecs_decode_amd64_adjust_offset_nonzero MOVQ R11, CX - JMP sequenceDecs_decode_amd64_adjust_end + JMP sequenceDecs_decode_amd64_after_adjust sequenceDecs_decode_amd64_adjust_offset_nonzero: CMPQ CX, $0x01 @@ -247,7 +264,7 @@ sequenceDecs_decode_amd64_adjust_temp_valid: MOVQ AX, R11 MOVQ AX, CX -sequenceDecs_decode_amd64_adjust_end: +sequenceDecs_decode_amd64_after_adjust: MOVQ CX, 16(R10) // Check values @@ -303,10 +320,6 @@ error_not_enough_literals: MOVQ $0x00000004, ret+24(FP) RET - // Return with not enough output space error - MOVQ $0x00000005, ret+24(FP) - RET - // func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // Requires: CMOV TEXT ·sequenceDecs_decode_56_amd64(SB), $8-32 @@ -356,49 +369,67 @@ sequenceDecs_decode_56_amd64_fill_byte_by_byte: sequenceDecs_decode_56_amd64_fill_end: // Update offset - MOVQ R9, AX - MOVQ BX, CX - MOVQ DX, R15 - SHLQ CL, R15 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R15 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R15 - ADDQ R15, AX - MOVQ AX, 16(R10) + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_of_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_of_update_zero: + MOVQ AX, 16(R10) // Update match length - MOVQ R8, AX - MOVQ BX, CX - MOVQ DX, R15 - SHLQ CL, R15 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R15 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R15 - ADDQ R15, AX - MOVQ AX, 8(R10) + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_ml_update_zero: + MOVQ AX, 8(R10) // Update literal length - MOVQ DI, AX - MOVQ BX, CX - MOVQ DX, R15 - SHLQ CL, R15 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R15 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R15 - ADDQ R15, AX - MOVQ AX, (R10) + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_ll_update_zero: + MOVQ AX, (R10) // Fill bitreader for state updates MOVQ R14, (SP) @@ -477,7 +508,7 @@ sequenceDecs_decode_56_amd64_skip_update: MOVQ R12, R13 MOVQ R11, R12 MOVQ CX, R11 - JMP sequenceDecs_decode_56_amd64_adjust_end + JMP sequenceDecs_decode_56_amd64_after_adjust sequenceDecs_decode_56_amd64_adjust_offsetB_1_or_0: CMPQ (R10), $0x00000000 @@ -489,7 +520,7 @@ sequenceDecs_decode_56_amd64_adjust_offset_maybezero: TESTQ CX, CX JNZ sequenceDecs_decode_56_amd64_adjust_offset_nonzero MOVQ R11, CX - JMP sequenceDecs_decode_56_amd64_adjust_end + JMP sequenceDecs_decode_56_amd64_after_adjust sequenceDecs_decode_56_amd64_adjust_offset_nonzero: CMPQ CX, $0x01 @@ -526,7 +557,7 @@ sequenceDecs_decode_56_amd64_adjust_temp_valid: MOVQ AX, R11 MOVQ AX, CX -sequenceDecs_decode_56_amd64_adjust_end: +sequenceDecs_decode_56_amd64_after_adjust: MOVQ CX, 16(R10) // Check values @@ -582,10 +613,6 @@ error_not_enough_literals: MOVQ $0x00000004, ret+24(FP) RET - // Return with not enough output space error - MOVQ $0x00000005, ret+24(FP) - RET - // func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // Requires: BMI, BMI2, CMOV TEXT ·sequenceDecs_decode_bmi2(SB), $8-32 @@ -757,7 +784,7 @@ sequenceDecs_decode_bmi2_skip_update: MOVQ R11, R12 MOVQ R10, R11 MOVQ CX, R10 - JMP sequenceDecs_decode_bmi2_adjust_end + JMP sequenceDecs_decode_bmi2_after_adjust sequenceDecs_decode_bmi2_adjust_offsetB_1_or_0: CMPQ (R9), $0x00000000 @@ -769,7 +796,7 @@ sequenceDecs_decode_bmi2_adjust_offset_maybezero: TESTQ CX, CX JNZ sequenceDecs_decode_bmi2_adjust_offset_nonzero MOVQ R10, CX - JMP sequenceDecs_decode_bmi2_adjust_end + JMP sequenceDecs_decode_bmi2_after_adjust sequenceDecs_decode_bmi2_adjust_offset_nonzero: CMPQ CX, $0x01 @@ -806,7 +833,7 @@ sequenceDecs_decode_bmi2_adjust_temp_valid: MOVQ R13, R10 MOVQ R13, CX -sequenceDecs_decode_bmi2_adjust_end: +sequenceDecs_decode_bmi2_after_adjust: MOVQ CX, 16(R9) // Check values @@ -862,10 +889,6 @@ error_not_enough_literals: MOVQ $0x00000004, ret+24(FP) RET - // Return with not enough output space error - MOVQ $0x00000005, ret+24(FP) - RET - // func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int // Requires: BMI, BMI2, CMOV TEXT ·sequenceDecs_decode_56_bmi2(SB), $8-32 @@ -1012,7 +1035,7 @@ sequenceDecs_decode_56_bmi2_skip_update: MOVQ R11, R12 MOVQ R10, R11 MOVQ CX, R10 - JMP sequenceDecs_decode_56_bmi2_adjust_end + JMP sequenceDecs_decode_56_bmi2_after_adjust sequenceDecs_decode_56_bmi2_adjust_offsetB_1_or_0: CMPQ (R9), $0x00000000 @@ -1024,7 +1047,7 @@ sequenceDecs_decode_56_bmi2_adjust_offset_maybezero: TESTQ CX, CX JNZ sequenceDecs_decode_56_bmi2_adjust_offset_nonzero MOVQ R10, CX - JMP sequenceDecs_decode_56_bmi2_adjust_end + JMP sequenceDecs_decode_56_bmi2_after_adjust sequenceDecs_decode_56_bmi2_adjust_offset_nonzero: CMPQ CX, $0x01 @@ -1061,7 +1084,7 @@ sequenceDecs_decode_56_bmi2_adjust_temp_valid: MOVQ R13, R10 MOVQ R13, CX -sequenceDecs_decode_56_bmi2_adjust_end: +sequenceDecs_decode_56_bmi2_after_adjust: MOVQ CX, 16(R9) // Check values @@ -1117,10 +1140,6 @@ error_not_enough_literals: MOVQ $0x00000004, ret+24(FP) RET - // Return with not enough output space error - MOVQ $0x00000005, ret+24(FP) - RET - // func sequenceDecs_executeSimple_amd64(ctx *executeAsmContext) bool // Requires: SSE TEXT ·sequenceDecs_executeSimple_amd64(SB), $8-9 @@ -1354,8 +1373,7 @@ loop_finished: MOVQ ctx+0(FP), AX MOVQ DX, 24(AX) MOVQ DI, 104(AX) - MOVQ 80(AX), CX - SUBQ CX, SI + SUBQ 80(AX), SI MOVQ SI, 112(AX) RET @@ -1367,8 +1385,7 @@ error_match_off_too_big: MOVQ ctx+0(FP), AX MOVQ DX, 24(AX) MOVQ DI, 104(AX) - MOVQ 80(AX), CX - SUBQ CX, SI + SUBQ 80(AX), SI MOVQ SI, 112(AX) RET @@ -1712,8 +1729,7 @@ loop_finished: MOVQ ctx+0(FP), AX MOVQ DX, 24(AX) MOVQ DI, 104(AX) - MOVQ 80(AX), CX - SUBQ CX, SI + SUBQ 80(AX), SI MOVQ SI, 112(AX) RET @@ -1725,8 +1741,7 @@ error_match_off_too_big: MOVQ ctx+0(FP), AX MOVQ DX, 24(AX) MOVQ DI, 104(AX) - MOVQ 80(AX), CX - SUBQ CX, SI + SUBQ 80(AX), SI MOVQ SI, 112(AX) RET @@ -1749,6 +1764,10 @@ TEXT ·sequenceDecs_decodeSync_amd64(SB), $64-32 MOVQ 72(AX), DI MOVQ 80(AX), R8 MOVQ 88(AX), R9 + XORQ CX, CX + MOVQ CX, 8(SP) + MOVQ CX, 16(SP) + MOVQ CX, 24(SP) MOVQ 112(AX), R10 MOVQ 128(AX), CX MOVQ CX, 32(SP) @@ -1798,34 +1817,46 @@ sequenceDecs_decodeSync_amd64_fill_byte_by_byte: sequenceDecs_decodeSync_amd64_fill_end: // Update offset - MOVQ R9, AX - MOVQ BX, CX - MOVQ DX, R14 - SHLQ CL, R14 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R14 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R14 - ADDQ R14, AX - MOVQ AX, 8(SP) + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_of_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_of_update_zero: + MOVQ AX, 8(SP) // Update match length - MOVQ R8, AX - MOVQ BX, CX - MOVQ DX, R14 - SHLQ CL, R14 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R14 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R14 - ADDQ R14, AX - MOVQ AX, 16(SP) + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_ml_update_zero: + MOVQ AX, 16(SP) // Fill bitreader to have enough for the remaining CMPQ SI, $0x08 @@ -1853,19 +1884,25 @@ sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte: sequenceDecs_decodeSync_amd64_fill_2_end: // Update literal length - MOVQ DI, AX - MOVQ BX, CX - MOVQ DX, R14 - SHLQ CL, R14 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R14 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R14 - ADDQ R14, AX - MOVQ AX, 24(SP) + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_ll_update_zero: + MOVQ AX, 24(SP) // Fill bitreader for state updates MOVQ R13, (SP) @@ -1945,7 +1982,7 @@ sequenceDecs_decodeSync_amd64_skip_update: MOVUPS 144(CX), X0 MOVQ R13, 144(CX) MOVUPS X0, 152(CX) - JMP sequenceDecs_decodeSync_amd64_adjust_end + JMP sequenceDecs_decodeSync_amd64_after_adjust sequenceDecs_decodeSync_amd64_adjust_offsetB_1_or_0: CMPQ 24(SP), $0x00000000 @@ -1957,7 +1994,7 @@ sequenceDecs_decodeSync_amd64_adjust_offset_maybezero: TESTQ R13, R13 JNZ sequenceDecs_decodeSync_amd64_adjust_offset_nonzero MOVQ 144(CX), R13 - JMP sequenceDecs_decodeSync_amd64_adjust_end + JMP sequenceDecs_decodeSync_amd64_after_adjust sequenceDecs_decodeSync_amd64_adjust_offset_nonzero: MOVQ R13, AX @@ -1966,8 +2003,7 @@ sequenceDecs_decodeSync_amd64_adjust_offset_nonzero: CMPQ R13, $0x03 CMOVQEQ R14, AX CMOVQEQ R15, R14 - LEAQ 144(CX), R15 - ADDQ (R15)(AX*8), R14 + ADDQ 144(CX)(AX*8), R14 JNZ sequenceDecs_decodeSync_amd64_adjust_temp_valid MOVQ $0x00000001, R14 @@ -1983,7 +2019,7 @@ sequenceDecs_decodeSync_amd64_adjust_skip: MOVQ R14, 144(CX) MOVQ R14, R13 -sequenceDecs_decodeSync_amd64_adjust_end: +sequenceDecs_decodeSync_amd64_after_adjust: MOVQ R13, 8(SP) // Check values @@ -2280,6 +2316,10 @@ TEXT ·sequenceDecs_decodeSync_bmi2(SB), $64-32 MOVQ 72(CX), SI MOVQ 80(CX), DI MOVQ 88(CX), R8 + XORQ R9, R9 + MOVQ R9, 8(SP) + MOVQ R9, 16(SP) + MOVQ R9, 24(SP) MOVQ 112(CX), R9 MOVQ 128(CX), R10 MOVQ R10, 32(SP) @@ -2452,7 +2492,7 @@ sequenceDecs_decodeSync_bmi2_skip_update: MOVUPS 144(CX), X0 MOVQ R13, 144(CX) MOVUPS X0, 152(CX) - JMP sequenceDecs_decodeSync_bmi2_adjust_end + JMP sequenceDecs_decodeSync_bmi2_after_adjust sequenceDecs_decodeSync_bmi2_adjust_offsetB_1_or_0: CMPQ 24(SP), $0x00000000 @@ -2464,7 +2504,7 @@ sequenceDecs_decodeSync_bmi2_adjust_offset_maybezero: TESTQ R13, R13 JNZ sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero MOVQ 144(CX), R13 - JMP sequenceDecs_decodeSync_bmi2_adjust_end + JMP sequenceDecs_decodeSync_bmi2_after_adjust sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero: MOVQ R13, R12 @@ -2473,8 +2513,7 @@ sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero: CMPQ R13, $0x03 CMOVQEQ R14, R12 CMOVQEQ R15, R14 - LEAQ 144(CX), R15 - ADDQ (R15)(R12*8), R14 + ADDQ 144(CX)(R12*8), R14 JNZ sequenceDecs_decodeSync_bmi2_adjust_temp_valid MOVQ $0x00000001, R14 @@ -2490,7 +2529,7 @@ sequenceDecs_decodeSync_bmi2_adjust_skip: MOVQ R14, 144(CX) MOVQ R14, R13 -sequenceDecs_decodeSync_bmi2_adjust_end: +sequenceDecs_decodeSync_bmi2_after_adjust: MOVQ R13, 8(SP) // Check values @@ -2787,6 +2826,10 @@ TEXT ·sequenceDecs_decodeSync_safe_amd64(SB), $64-32 MOVQ 72(AX), DI MOVQ 80(AX), R8 MOVQ 88(AX), R9 + XORQ CX, CX + MOVQ CX, 8(SP) + MOVQ CX, 16(SP) + MOVQ CX, 24(SP) MOVQ 112(AX), R10 MOVQ 128(AX), CX MOVQ CX, 32(SP) @@ -2836,34 +2879,46 @@ sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte: sequenceDecs_decodeSync_safe_amd64_fill_end: // Update offset - MOVQ R9, AX - MOVQ BX, CX - MOVQ DX, R14 - SHLQ CL, R14 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R14 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R14 - ADDQ R14, AX - MOVQ AX, 8(SP) + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_of_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_of_update_zero: + MOVQ AX, 8(SP) // Update match length - MOVQ R8, AX - MOVQ BX, CX - MOVQ DX, R14 - SHLQ CL, R14 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R14 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R14 - ADDQ R14, AX - MOVQ AX, 16(SP) + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_ml_update_zero: + MOVQ AX, 16(SP) // Fill bitreader to have enough for the remaining CMPQ SI, $0x08 @@ -2891,19 +2946,25 @@ sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte: sequenceDecs_decodeSync_safe_amd64_fill_2_end: // Update literal length - MOVQ DI, AX - MOVQ BX, CX - MOVQ DX, R14 - SHLQ CL, R14 - MOVB AH, CL - ADDQ CX, BX - NEGL CX - SHRQ CL, R14 - SHRQ $0x20, AX - TESTQ CX, CX - CMOVQEQ CX, R14 - ADDQ R14, AX - MOVQ AX, 24(SP) + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_ll_update_zero: + MOVQ AX, 24(SP) // Fill bitreader for state updates MOVQ R13, (SP) @@ -2983,7 +3044,7 @@ sequenceDecs_decodeSync_safe_amd64_skip_update: MOVUPS 144(CX), X0 MOVQ R13, 144(CX) MOVUPS X0, 152(CX) - JMP sequenceDecs_decodeSync_safe_amd64_adjust_end + JMP sequenceDecs_decodeSync_safe_amd64_after_adjust sequenceDecs_decodeSync_safe_amd64_adjust_offsetB_1_or_0: CMPQ 24(SP), $0x00000000 @@ -2995,7 +3056,7 @@ sequenceDecs_decodeSync_safe_amd64_adjust_offset_maybezero: TESTQ R13, R13 JNZ sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero MOVQ 144(CX), R13 - JMP sequenceDecs_decodeSync_safe_amd64_adjust_end + JMP sequenceDecs_decodeSync_safe_amd64_after_adjust sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero: MOVQ R13, AX @@ -3004,8 +3065,7 @@ sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero: CMPQ R13, $0x03 CMOVQEQ R14, AX CMOVQEQ R15, R14 - LEAQ 144(CX), R15 - ADDQ (R15)(AX*8), R14 + ADDQ 144(CX)(AX*8), R14 JNZ sequenceDecs_decodeSync_safe_amd64_adjust_temp_valid MOVQ $0x00000001, R14 @@ -3021,7 +3081,7 @@ sequenceDecs_decodeSync_safe_amd64_adjust_skip: MOVQ R14, 144(CX) MOVQ R14, R13 -sequenceDecs_decodeSync_safe_amd64_adjust_end: +sequenceDecs_decodeSync_safe_amd64_after_adjust: MOVQ R13, 8(SP) // Check values @@ -3420,6 +3480,10 @@ TEXT ·sequenceDecs_decodeSync_safe_bmi2(SB), $64-32 MOVQ 72(CX), SI MOVQ 80(CX), DI MOVQ 88(CX), R8 + XORQ R9, R9 + MOVQ R9, 8(SP) + MOVQ R9, 16(SP) + MOVQ R9, 24(SP) MOVQ 112(CX), R9 MOVQ 128(CX), R10 MOVQ R10, 32(SP) @@ -3592,7 +3656,7 @@ sequenceDecs_decodeSync_safe_bmi2_skip_update: MOVUPS 144(CX), X0 MOVQ R13, 144(CX) MOVUPS X0, 152(CX) - JMP sequenceDecs_decodeSync_safe_bmi2_adjust_end + JMP sequenceDecs_decodeSync_safe_bmi2_after_adjust sequenceDecs_decodeSync_safe_bmi2_adjust_offsetB_1_or_0: CMPQ 24(SP), $0x00000000 @@ -3604,7 +3668,7 @@ sequenceDecs_decodeSync_safe_bmi2_adjust_offset_maybezero: TESTQ R13, R13 JNZ sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero MOVQ 144(CX), R13 - JMP sequenceDecs_decodeSync_safe_bmi2_adjust_end + JMP sequenceDecs_decodeSync_safe_bmi2_after_adjust sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero: MOVQ R13, R12 @@ -3613,8 +3677,7 @@ sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero: CMPQ R13, $0x03 CMOVQEQ R14, R12 CMOVQEQ R15, R14 - LEAQ 144(CX), R15 - ADDQ (R15)(R12*8), R14 + ADDQ 144(CX)(R12*8), R14 JNZ sequenceDecs_decodeSync_safe_bmi2_adjust_temp_valid MOVQ $0x00000001, R14 @@ -3630,7 +3693,7 @@ sequenceDecs_decodeSync_safe_bmi2_adjust_skip: MOVQ R14, 144(CX) MOVQ R14, R13 -sequenceDecs_decodeSync_safe_bmi2_adjust_end: +sequenceDecs_decodeSync_safe_bmi2_after_adjust: MOVQ R13, 8(SP) // Check values diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go index c3452bc3..ac2a80d2 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go @@ -111,7 +111,7 @@ func (s *sequenceDecs) decode(seqs []seqVals) error { } s.seqSize += ll + ml if s.seqSize > maxBlockSize { - return fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) } litRemain -= ll if litRemain < 0 { @@ -149,7 +149,7 @@ func (s *sequenceDecs) decode(seqs []seqVals) error { } s.seqSize += litRemain if s.seqSize > maxBlockSize { - return fmt.Errorf("output (%d) bigger than max block size (%d)", s.seqSize, maxBlockSize) + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) } err := br.close() if err != nil { diff --git a/vendor/github.com/klauspost/compress/zstd/zstd.go b/vendor/github.com/klauspost/compress/zstd/zstd.go index 3eb3f1c8..5ffa82f5 100644 --- a/vendor/github.com/klauspost/compress/zstd/zstd.go +++ b/vendor/github.com/klauspost/compress/zstd/zstd.go @@ -36,9 +36,6 @@ const forcePreDef = false // zstdMinMatch is the minimum zstd match length. const zstdMinMatch = 3 -// Reset the buffer offset when reaching this. -const bufferReset = math.MaxInt32 - MaxWindowSize - // fcsUnknown is used for unknown frame content size. const fcsUnknown = math.MaxUint64 @@ -75,7 +72,6 @@ var ( ErrDecoderSizeExceeded = errors.New("decompressed size exceeds configured limit") // ErrUnknownDictionary is returned if the dictionary ID is unknown. - // For the time being dictionaries are not supported. ErrUnknownDictionary = errors.New("unknown dictionary") // ErrFrameSizeExceeded is returned if the stated frame size is exceeded. @@ -110,26 +106,25 @@ func printf(format string, a ...interface{}) { } } -// matchLen returns the maximum length. +// matchLen returns the maximum common prefix length of a and b. // a must be the shortest of the two. -// The function also returns whether all bytes matched. -func matchLen(a, b []byte) int { - b = b[:len(a)] - for i := 0; i < len(a)-7; i += 8 { - if diff := load64(a, i) ^ load64(b, i); diff != 0 { - return i + (bits.TrailingZeros64(diff) >> 3) +func matchLen(a, b []byte) (n int) { + for ; len(a) >= 8 && len(b) >= 8; a, b = a[8:], b[8:] { + diff := binary.LittleEndian.Uint64(a) ^ binary.LittleEndian.Uint64(b) + if diff != 0 { + return n + bits.TrailingZeros64(diff)>>3 } + n += 8 } - checked := (len(a) >> 3) << 3 - a = a[checked:] - b = b[checked:] for i := range a { if a[i] != b[i] { - return i + checked + break } + n++ } - return len(a) + checked + return n + } func load3232(b []byte, i int32) uint32 { @@ -140,10 +135,6 @@ func load6432(b []byte, i int32) uint64 { return binary.LittleEndian.Uint64(b[i:]) } -func load64(b []byte, i int) uint64 { - return binary.LittleEndian.Uint64(b[i:]) -} - type byter interface { Bytes() []byte Len() int diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index bc2f98f0..857a93e5 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -16,10 +16,17 @@ Package home: https://github.com/klauspost/cpuid ## installing -`go get -u github.com/klauspost/cpuid/v2` using modules. - +`go get -u github.com/klauspost/cpuid/v2` using modules. Drop `v2` for others. +### Homebrew + +For macOS/Linux users, you can install via [brew](https://brew.sh/) + +```sh +$ brew install cpuid +``` + ## example ```Go @@ -77,10 +84,14 @@ We have Streaming SIMD 2 Extensions The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. +To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc. +This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported. + Note that for some cpu/os combinations some features will not be detected. `amd64` has rather good support and should work reliably on all platforms. -Note that hypervisors may not pass through all CPU features. +Note that hypervisors may not pass through all CPU features through to the guest OS, +so even if your host supports a feature it may not be visible on guests. ## arm64 feature detection @@ -132,6 +143,339 @@ func main() { } ``` +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + + +## Available flags + +### x86 & amd64 + +| Feature Flag | Description | +|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) | +| AESNI | Advanced Encryption Standard New Instructions | +| AMD3DNOW | AMD 3DNOW | +| AMD3DNOWEXT | AMD 3DNowExt | +| AMXBF16 | Tile computational operations on BFLOAT16 numbers | +| AMXINT8 | Tile computational operations on 8-bit integers | +| AMXFP16 | Tile computational operations on FP16 numbers | +| AMXTILE | Tile architecture | +| AVX | AVX functions | +| AVX2 | AVX2 functions | +| AVX512BF16 | AVX-512 BFLOAT16 Instructions | +| AVX512BITALG | AVX-512 Bit Algorithms | +| AVX512BW | AVX-512 Byte and Word Instructions | +| AVX512CD | AVX-512 Conflict Detection Instructions | +| AVX512DQ | AVX-512 Doubleword and Quadword Instructions | +| AVX512ER | AVX-512 Exponential and Reciprocal Instructions | +| AVX512F | AVX-512 Foundation | +| AVX512FP16 | AVX-512 FP16 Instructions | +| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions | +| AVX512PF | AVX-512 Prefetch Instructions | +| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions | +| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 | +| AVX512VL | AVX-512 Vector Length Extensions | +| AVX512VNNI | AVX-512 Vector Neural Network Instructions | +| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q | +| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword | +| AVXIFMA | AVX-IFMA instructions | +| AVXNECONVERT | AVX-NE-CONVERT instructions | +| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | +| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | +| AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| BMI1 | Bit Manipulation Instruction Set 1 | +| BMI2 | Bit Manipulation Instruction Set 2 | +| CETIBT | Intel CET Indirect Branch Tracking | +| CETSS | Intel CET Shadow Stack | +| CLDEMOTE | Cache Line Demote | +| CLMUL | Carry-less Multiplication | +| CLZERO | CLZERO instruction supported | +| CMOV | i686 CMOV | +| CMPCCXADD | CMPCCXADD instructions | +| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB | +| CMPXCHG8 | CMPXCHG8 instruction | +| CPBOOST | Core Performance Boost | +| CPPC | AMD: Collaborative Processor Performance Control | +| CX16 | CMPXCHG16B Instruction | +| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ | +| ENQCMD | Enqueue Command | +| ERMS | Enhanced REP MOVSB/STOSB | +| F16C | Half-precision floating-point conversion | +| FLUSH_L1D | Flush L1D cache | +| FMA3 | Intel FMA 3. Does not imply AVX. | +| FMA4 | Bulldozer FMA4 functions | +| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide | +| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide | +| FSRM | Fast Short Rep Mov | +| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 | +| FXSROPT | FXSAVE/FXRSTOR optimizations | +| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. | +| HLE | Hardware Lock Elision | +| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR | +| HTT | Hyperthreading (enabled) | +| HWA | Hardware assert supported. Indicates support for MSRC001_10 | +| HYBRID_CPU | This part has CPUs of more than one type. | +| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors | +| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) | +| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR | +| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) | +| IBRS | AMD: Indirect Branch Restricted Speculation | +| IBRS_PREFERRED | AMD: IBRS is preferred over software solution | +| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection | +| IBS | Instruction Based Sampling (AMD) | +| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) | +| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) | +| IBSFFV | Instruction Based Sampling Feature (AMD) | +| IBSOPCNT | Instruction Based Sampling Feature (AMD) | +| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) | +| IBSOPSAM | Instruction Based Sampling Feature (AMD) | +| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) | +| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) | +| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported | +| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported | +| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse | +| IBS_PREVENTHOST | Disallowing IBS use by the host supported | +| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 | +| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | +| INVLPGB | NVLPGB and TLBSYNC instruction supported | +| LAHF | LAHF/SAHF in long mode | +| LAM | If set, CPU supports Linear Address Masking | +| LBRVIRT | LBR virtualization | +| LZCNT | LZCNT instruction | +| MCAOVERFLOW | MCA overflow recovery support. | +| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. | +| MCOMMIT | MCOMMIT instruction supported | +| MD_CLEAR | VERW clears CPU buffers | +| MMX | standard MMX | +| MMXEXT | SSE integer functions or AMD MMX ext | +| MOVBE | MOVBE instruction (big-endian) | +| MOVDIR64B | Move 64 Bytes as Direct Store | +| MOVDIRI | Move Doubleword as Direct Store | +| MOVSB_ZL | Fast Zero-Length MOVSB | +| MPX | Intel MPX (Memory Protection Extensions) | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MSRIRC | Instruction Retired Counter MSR available | +| MSR_PAGEFLUSH | Page Flush MSR available | +| NRIPS | Indicates support for NRIP save on VMEXIT | +| NX | NX (No-Execute) bit | +| OSXSAVE | XSAVE enabled by OS | +| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption | +| POPCNT | POPCNT instruction | +| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled | +| PREFETCHI | PREFETCHIT0/1 instructions | +| PSFD | AMD: Predictive Store Forward Disable | +| RDPRU | RDPRU instruction supported | +| RDRAND | RDRAND instruction is available | +| RDSEED | RDSEED instruction is available | +| RDTSCP | RDTSCP Instruction | +| RTM | Restricted Transactional Memory | +| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. | +| SERIALIZE | Serialize Instruction Execution | +| SEV | AMD Secure Encrypted Virtualization supported | +| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host | +| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported | +| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests | +| SEV_ES | AMD SEV Encrypted State supported | +| SEV_RESTRICTED | AMD SEV Restricted Injection supported | +| SEV_SNP | AMD SEV Secure Nested Paging supported | +| SGX | Software Guard Extensions | +| SGXLC | Software Guard Extensions Launch Control | +| SHA | Intel SHA Extensions | +| SME | AMD Secure Memory Encryption supported | +| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SPEC_CTRL_SSBD | Speculative Store Bypass Disable | +| SRBDS_CTRL | SRBDS mitigation MSR available | +| SSE | SSE functions | +| SSE2 | P4 SSE functions | +| SSE3 | Prescott SSE3 functions | +| SSE4 | Penryn SSE4.1 functions | +| SSE42 | Nehalem SSE4.2 functions | +| SSE4A | AMD Barcelona microarchitecture SSE4a instructions | +| SSSE3 | Conroe SSSE3 functions | +| STIBP | Single Thread Indirect Branch Predictors | +| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On | +| STOSB_SHORT | Fast short STOSB | +| SUCCOR | Software uncorrectable error containment and recovery capability. | +| SVM | AMD Secure Virtual Machine | +| SVMDA | Indicates support for the SVM decode assists. | +| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control | +| SVML | AMD SVM lock. Indicates support for SVM-Lock. | +| SVMNP | AMD SVM nested paging | +| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter | +| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold | +| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | +| SYSEE | SYSENTER and SYSEXIT instructions | +| TBM | AMD Trailing Bit Manipulation | +| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | +| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | +| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | +| TSXLDTRK | Intel TSX Suspend Load Address Tracking | +| VAES | Vector AES. AVX(512) versions requires additional checks. | +| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. | +| VMPL | AMD VM Permission Levels supported | +| VMSA_REGPROT | AMD VMSA Register Protection supported | +| VMX | Virtual Machine Extensions | +| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. | +| VTE | AMD Virtual Transparent Encryption supported | +| WAITPKG | TPAUSE, UMONITOR, UMWAIT | +| WBNOINVD | Write Back and Do Not Invalidate Cache | +| X87 | FPU | +| XGETBV1 | Supports XGETBV with ECX = 1 | +| XOP | Bulldozer XOP functions | +| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV | +| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. | +| XSAVEOPT | XSAVEOPT available | +| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS | + +# ARM features: + +| Feature Flag | Description | +|--------------|------------------------------------------------------------------| +| AESARM | AES instructions | +| ARMCPUID | Some CPU ID registers readable at user-level | +| ASIMD | Advanced SIMD | +| ASIMDDP | SIMD Dot Product | +| ASIMDHP | Advanced SIMD half-precision floating point | +| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) | +| ATOMICS | Large System Extensions (LSE) | +| CRC32 | CRC32/CRC32C instructions | +| DCPOP | Data cache clean to Point of Persistence (DC CVAP) | +| EVTSTRM | Generic timer | +| FCMA | Floatin point complex number addition and multiplication | +| FP | Single-precision and double-precision floating point | +| FPHP | Half-precision floating point | +| GPA | Generic Pointer Authentication | +| JSCVT | Javascript-style double->int convert (FJCVTZS) | +| LRCPC | Weaker release consistency (LDAPR, etc) | +| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| SHA1 | SHA-1 instructions (SHA1C, etc) | +| SHA2 | SHA-2 instructions (SHA256H, etc) | +| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | +| SHA512 | SHA512 instructions | +| SM3 | SM3 instructions | +| SM4 | SM4 instructions | +| SVE | Scalable Vector Extension | + # license This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 3d543ce9..cf2ae9c5 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -14,6 +14,7 @@ import ( "flag" "fmt" "math" + "math/bits" "os" "runtime" "strings" @@ -72,6 +73,7 @@ const ( AMD3DNOW // AMD 3DNOW AMD3DNOWEXT // AMD 3DNowExt AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers AMXTILE // Tile architecture AVX // AVX functions @@ -92,7 +94,11 @@ const ( AVX512VNNI // AVX-512 Vector Neural Network Instructions AVX512VP2INTERSECT // AVX-512 Intersect for D/Q AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one. + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions BMI1 // Bit Manipulation Instruction Set 1 BMI2 // Bit Manipulation Instruction Set 2 CETIBT // Intel CET Indirect Branch Tracking @@ -101,22 +107,37 @@ const ( CLMUL // Carry-less Multiplication CLZERO // CLZERO instruction supported CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB CMPXCHG8 // CMPXCHG8 instruction CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ ENQCMD // Enqueue Command ERMS // Enhanced REP MOVSB/STOSB F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache FMA3 // Intel FMA 3. Does not imply AVX. FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 FXSROPT // FXSAVE/FXRSTOR optimizations - GFNI // Galois Field New Instructions + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR HTT // Hyperthreading (enabled) HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection IBS // Instruction Based Sampling (AMD) IBSBRNTRGT // Instruction Based Sampling Feature (AMD) IBSFETCHSAM // Instruction Based Sampling Feature (AMD) @@ -126,33 +147,60 @@ const ( IBSOPSAM // Instruction Based Sampling Feature (AMD) IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 INT_WBINVD // WBINVD/WBNOINVD are interruptible. INVLPGB // NVLPGB and TLBSYNC instruction supported LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization LZCNT // LZCNT instruction MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers MMX // standard MMX MMXEXT // SSE integer functions or AMD MMX ext MOVBE // MOVBE instruction (big-endian) MOVDIR64B // Move 64 Bytes as Direct Store MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD MPX // Intel MPX (Memory Protection Extensions) MSRIRC // Instruction Retired Counter MSR available + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT NX // NX (No-Execute) bit OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // AMD: Predictive Store Forward Disable RDPRU // RDPRU instruction supported RDRAND // RDRAND instruction is available RDSEED // RDSEED instruction is available RDTSCP // RDTSCP Instruction RTM // Restricted Transactional Memory RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. - SCE // SYSENTER and SYSEXIT instructions SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported SGX // Software Guard Extensions SGXLC // Software Guard Extensions Launch Control SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available SSE // SSE functions SSE2 // P4 SSE functions SSE3 // Prescott SSE3 functions @@ -161,17 +209,40 @@ const ( SSE4A // AMD Barcelona microarchitecture SSE4a instructions SSSE3 // Conroe SSSE3 functions STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions TBM // AMD Trailing Bit Manipulation + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported WAITPKG // TPAUSE, UMONITOR, UMWAIT WBNOINVD // Write Back and Do Not Invalidate Cache X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 XOP // Bulldozer XOP functions XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -198,7 +269,6 @@ const ( SM3 // SM3 instructions SM4 // SM4 instructions SVE // Scalable Vector Extension - // Keep it last. It automatically defines the size of []flagSet lastID @@ -216,6 +286,7 @@ type CPUInfo struct { LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. Family int // CPU family number Model int // CPU model number + Stepping int // CPU stepping info CacheLine int // Cache line size in bytes. Will be 0 if undetectable. Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. BoostFreq int64 // Max clock speed, if known, 0 otherwise @@ -318,30 +389,61 @@ func (c CPUInfo) Supports(ids ...FeatureID) bool { // Has allows for checking a single feature. // Should be inlined by the compiler. -func (c CPUInfo) Has(id FeatureID) bool { +func (c *CPUInfo) Has(id FeatureID) bool { return c.featureSet.inSet(id) } +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// Features contains several features combined for a fast check using +// CpuInfo.HasAll +type Features *flagSet + +// CombineFeatures allows to combine several features for a close to constant time lookup. +func CombineFeatures(ids ...FeatureID) Features { + var v flagSet + for _, id := range ids { + v.set(id) + } + return &v +} + +func (c *CPUInfo) HasAll(f Features) bool { + return c.featureSet.hasSetP(f) +} + // https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels -var level1Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2) -var level2Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) -var level3Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) -var level4Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SCE, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) +var oneOfLevel = CombineFeatures(SYSEE, SYSCALL) +var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2) +var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) // X64Level returns the microarchitecture level detected on the CPU. // If features are lacking or non x64 mode, 0 is returned. // See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels func (c CPUInfo) X64Level() int { - if c.featureSet.hasSet(level4Features) { + if !c.featureSet.hasOneOf(oneOfLevel) { + return 0 + } + if c.featureSet.hasSetP(level4Features) { return 4 } - if c.featureSet.hasSet(level3Features) { + if c.featureSet.hasSetP(level3Features) { return 3 } - if c.featureSet.hasSet(level2Features) { + if c.featureSet.hasSetP(level2Features) { return 2 } - if c.featureSet.hasSet(level1Features) { + if c.featureSet.hasSetP(level1Features) { return 1 } return 0 @@ -369,8 +471,9 @@ func (c CPUInfo) IsVendor(v Vendor) bool { return c.VendorID == v } +// FeatureSet returns all available features as strings. func (c CPUInfo) FeatureSet() []string { - s := make([]string, 0) + s := make([]string, 0, c.featureSet.nEnabled()) s = append(s, c.featureSet.Strings()...) return s } @@ -504,7 +607,7 @@ const flagMask = flagBits - 1 // flagSet contains detected cpu features and characteristics in an array of flags type flagSet [(lastID + flagMask) / flagBits]flags -func (s flagSet) inSet(feat FeatureID) bool { +func (s *flagSet) inSet(feat FeatureID) bool { return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 } @@ -534,7 +637,7 @@ func (s *flagSet) or(other flagSet) { } // hasSet returns whether all features are present. -func (s flagSet) hasSet(other flagSet) bool { +func (s *flagSet) hasSet(other flagSet) bool { for i, v := range other[:] { if s[i]&v != v { return false @@ -543,6 +646,34 @@ func (s flagSet) hasSet(other flagSet) bool { return true } +// hasSet returns whether all features are present. +func (s *flagSet) hasSetP(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasOneOf returns whether one or more features are present. +func (s *flagSet) hasOneOf(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != 0 { + return true + } + } + return false +} + +// nEnabled will return the number of enabled flags. +func (s *flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + func flagSetWith(feat ...FeatureID) flagSet { var res flagSet for _, f := range feat { @@ -631,7 +762,7 @@ func threadsPerCore() int { if vend == AMD { // Workaround for AMD returning 0, assume 2 if >= Zen 2 // It will be more correct than not. - fam, _ := familyModel() + fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { return 2 @@ -669,14 +800,27 @@ func logicalCores() int { } } -func familyModel() (int, int) { +func familyModel() (family, model, stepping int) { if maxFunctionID() < 0x1 { - return 0, 0 + return 0, 0, 0 } eax, _, _, _ := cpuid(1) - family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff) - model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0) - return int(family), int(model) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping } func physicalCores() int { @@ -811,9 +955,14 @@ func (c *CPUInfo) cacheSize() { c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties - if maxExtendedFunction() < 0x8000001D { + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { return } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 for i := uint32(0); i < math.MaxUint32; i++ { eax, ebx, ecx, _ := cpuidex(0x8000001D, i) @@ -829,6 +978,16 @@ func (c *CPUInfo) cacheSize() { return } + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + switch level { case 1: switch typ { @@ -913,14 +1072,13 @@ func support() flagSet { if mfi < 0x1 { return fs } - family, model := familyModel() + family, model, _ := familyModel() _, _, c, d := cpuid(1) fs.setIf((d&(1<<0)) != 0, X87) fs.setIf((d&(1<<8)) != 0, CMPXCHG8) - fs.setIf((d&(1<<11)) != 0, SCE) + fs.setIf((d&(1<<11)) != 0, SYSEE) fs.setIf((d&(1<<15)) != 0, CMOV) - fs.setIf((d&(1<<22)) != 0, MMXEXT) fs.setIf((d&(1<<23)) != 0, MMX) fs.setIf((d&(1<<24)) != 0, FXSR) fs.setIf((d&(1<<25)) != 0, FXSROPT) @@ -928,9 +1086,9 @@ func support() flagSet { fs.setIf((d&(1<<26)) != 0, SSE2) fs.setIf((c&1) != 0, SSE3) fs.setIf((c&(1<<5)) != 0, VMX) - fs.setIf((c&0x00000200) != 0, SSSE3) - fs.setIf((c&0x00080000) != 0, SSE4) - fs.setIf((c&0x00100000) != 0, SSE42) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) fs.setIf((c&(1<<25)) != 0, AESNI) fs.setIf((c&(1<<1)) != 0, CLMUL) fs.setIf(c&(1<<22) != 0, MOVBE) @@ -976,7 +1134,6 @@ func support() flagSet { // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. if mfi >= 7 { _, ebx, ecx, edx := cpuidex(7, 0) - eax1, _, _, _ := cpuidex(7, 1) if fs.inSet(AVX) && (ebx&0x00000020) != 0 { fs.set(AVX2) } @@ -993,21 +1150,52 @@ func support() flagSet { fs.setIf(ebx&(1<<18) != 0, RDSEED) fs.setIf(ebx&(1<<19) != 0, ADX) fs.setIf(ebx&(1<<29) != 0, SHA) + // CPUID.(EAX=7, ECX=0).ECX fs.setIf(ecx&(1<<5) != 0, WAITPKG) fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) fs.setIf(ecx&(1<<30) != 0, SGXLC) + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<4) != 0, FSRM) + fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL) + fs.setIf(edx&(1<<10) != 0, MD_CLEAR) fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<15) != 0, HYBRID_CPU) fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) fs.setIf(edx&(1<<20) != 0, CETIBT) fs.setIf(edx&(1<<26) != 0, IBPB) fs.setIf(edx&(1<<27) != 0, STIBP) + fs.setIf(edx&(1<<28) != 0, FLUSH_L1D) + fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP) + fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) + fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) + + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx&(1<<14) != 0, PREFETCHI) + + // CPUID.(EAX=7, ECX=1).EAX + eax1, _, _, _ := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<23) != 0, AVXIFMA) + fs.setIf(eax1&(1<<26) != 0, LAM) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -1033,9 +1221,6 @@ func support() flagSet { // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) - fs.setIf(ecx&(1<<8) != 0, GFNI) - fs.setIf(ecx&(1<<9) != 0, VAES) - fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) @@ -1047,31 +1232,66 @@ func support() flagSet { fs.setIf(edx&(1<<25) != 0, AMXINT8) // eax1 = CPUID.(EAX=7, ECX=1).EAX fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + fs.setIf(eax1&(1<<21) != 0, AMXFP16) } } + + // CPUID.(EAX=7, ECX=2) + _, _, _, edx = cpuidex(7, 2) + fs.setIf(edx&(1<<5) != 0, MCDT_NO) } + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } if maxExtendedFunction() >= 0x80000001 { _, _, c, d := cpuid(0x80000001) if (c & (1 << 5)) != 0 { fs.set(LZCNT) fs.set(POPCNT) } + // ECX fs.setIf((c&(1<<0)) != 0, LAHF) - fs.setIf((c&(1<<10)) != 0, IBS) - fs.setIf((d&(1<<31)) != 0, AMD3DNOW) - fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT) - fs.setIf((d&(1<<23)) != 0, MMX) - fs.setIf((d&(1<<22)) != 0, MMXEXT) + fs.setIf((c&(1<<2)) != 0, SVM) fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be * used unless the OS has AVX support. */ if fs.inSet(AVX) { - fs.setIf((c&0x00000800) != 0, XOP) - fs.setIf((c&0x00010000) != 0, FMA4) + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) } } @@ -1085,15 +1305,48 @@ func support() flagSet { if maxExtendedFunction() >= 0x80000008 { _, b, _, _ := cpuid(0x80000008) + fs.setIf(b&(1<<28) != 0, PSFD) + fs.setIf(b&(1<<27) != 0, CPPC) + fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD) + fs.setIf(b&(1<<23) != 0, PPIN) + fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED) + fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS) + fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP) + fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED) + fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON) + fs.setIf(b&(1<<15) != 0, STIBP) + fs.setIf(b&(1<<14) != 0, IBRS) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf(b&(1<<12) != 0, IBPB) fs.setIf((b&(1<<9)) != 0, WBNOINVD) fs.setIf((b&(1<<8)) != 0, MCOMMIT) - fs.setIf((b&(1<<13)) != 0, INT_WBINVD) fs.setIf((b&(1<<4)) != 0, RDPRU) fs.setIf((b&(1<<3)) != 0, INVLPGB) fs.setIf((b&(1<<1)) != 0, MSRIRC) fs.setIf((b&(1<<0)) != 0, CLZERO) } + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001a { + eax, _, _, _ := cpuid(0x8000001a) + fs.setIf((eax>>0)&1 == 1, FP128) + fs.setIf((eax>>1)&1 == 1, MOVU) + fs.setIf((eax>>2)&1 == 1, FP256) + } + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { eax, _, _, _ := cpuid(0x8000001b) fs.setIf((eax>>0)&1 == 1, IBSFFV) @@ -1104,6 +1357,28 @@ func support() flagSet { fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE) + fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX) + fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1. + fs.setIf((eax>>11)&1 == 1, IBS_ZEN4) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } return fs diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 35678d8a..c946824e 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -24,7 +24,7 @@ func addInfo(c *CPUInfo, safe bool) { c.maxExFunc = maxExtendedFunction() c.BrandName = brandName() c.CacheLine = cacheLine() - c.Family, c.Model = familyModel() + c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) c.ThreadsPerCore = threadsPerCore() diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 02fe232a..8b6cd2b7 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -13,137 +13,207 @@ func _() { _ = x[AMD3DNOW-3] _ = x[AMD3DNOWEXT-4] _ = x[AMXBF16-5] - _ = x[AMXINT8-6] - _ = x[AMXTILE-7] - _ = x[AVX-8] - _ = x[AVX2-9] - _ = x[AVX512BF16-10] - _ = x[AVX512BITALG-11] - _ = x[AVX512BW-12] - _ = x[AVX512CD-13] - _ = x[AVX512DQ-14] - _ = x[AVX512ER-15] - _ = x[AVX512F-16] - _ = x[AVX512FP16-17] - _ = x[AVX512IFMA-18] - _ = x[AVX512PF-19] - _ = x[AVX512VBMI-20] - _ = x[AVX512VBMI2-21] - _ = x[AVX512VL-22] - _ = x[AVX512VNNI-23] - _ = x[AVX512VP2INTERSECT-24] - _ = x[AVX512VPOPCNTDQ-25] - _ = x[AVXSLOW-26] - _ = x[BMI1-27] - _ = x[BMI2-28] - _ = x[CETIBT-29] - _ = x[CETSS-30] - _ = x[CLDEMOTE-31] - _ = x[CLMUL-32] - _ = x[CLZERO-33] - _ = x[CMOV-34] - _ = x[CMPXCHG8-35] - _ = x[CPBOOST-36] - _ = x[CX16-37] - _ = x[ENQCMD-38] - _ = x[ERMS-39] - _ = x[F16C-40] - _ = x[FMA3-41] - _ = x[FMA4-42] - _ = x[FXSR-43] - _ = x[FXSROPT-44] - _ = x[GFNI-45] - _ = x[HLE-46] - _ = x[HTT-47] - _ = x[HWA-48] - _ = x[HYPERVISOR-49] - _ = x[IBPB-50] - _ = x[IBS-51] - _ = x[IBSBRNTRGT-52] - _ = x[IBSFETCHSAM-53] - _ = x[IBSFFV-54] - _ = x[IBSOPCNT-55] - _ = x[IBSOPCNTEXT-56] - _ = x[IBSOPSAM-57] - _ = x[IBSRDWROPCNT-58] - _ = x[IBSRIPINVALIDCHK-59] - _ = x[INT_WBINVD-60] - _ = x[INVLPGB-61] - _ = x[LAHF-62] - _ = x[LZCNT-63] - _ = x[MCAOVERFLOW-64] - _ = x[MCOMMIT-65] - _ = x[MMX-66] - _ = x[MMXEXT-67] - _ = x[MOVBE-68] - _ = x[MOVDIR64B-69] - _ = x[MOVDIRI-70] - _ = x[MPX-71] - _ = x[MSRIRC-72] - _ = x[NX-73] - _ = x[OSXSAVE-74] - _ = x[POPCNT-75] - _ = x[RDPRU-76] - _ = x[RDRAND-77] - _ = x[RDSEED-78] - _ = x[RDTSCP-79] - _ = x[RTM-80] - _ = x[RTM_ALWAYS_ABORT-81] - _ = x[SCE-82] - _ = x[SERIALIZE-83] - _ = x[SGX-84] - _ = x[SGXLC-85] - _ = x[SHA-86] - _ = x[SSE-87] - _ = x[SSE2-88] - _ = x[SSE3-89] - _ = x[SSE4-90] - _ = x[SSE42-91] - _ = x[SSE4A-92] - _ = x[SSSE3-93] - _ = x[STIBP-94] - _ = x[SUCCOR-95] - _ = x[TBM-96] - _ = x[TSXLDTRK-97] - _ = x[VAES-98] - _ = x[VMX-99] - _ = x[VPCLMULQDQ-100] - _ = x[WAITPKG-101] - _ = x[WBNOINVD-102] - _ = x[X87-103] - _ = x[XOP-104] - _ = x[XSAVE-105] - _ = x[AESARM-106] - _ = x[ARMCPUID-107] - _ = x[ASIMD-108] - _ = x[ASIMDDP-109] - _ = x[ASIMDHP-110] - _ = x[ASIMDRDM-111] - _ = x[ATOMICS-112] - _ = x[CRC32-113] - _ = x[DCPOP-114] - _ = x[EVTSTRM-115] - _ = x[FCMA-116] - _ = x[FP-117] - _ = x[FPHP-118] - _ = x[GPA-119] - _ = x[JSCVT-120] - _ = x[LRCPC-121] - _ = x[PMULL-122] - _ = x[SHA1-123] - _ = x[SHA2-124] - _ = x[SHA3-125] - _ = x[SHA512-126] - _ = x[SM3-127] - _ = x[SM4-128] - _ = x[SVE-129] - _ = x[lastID-130] + _ = x[AMXFP16-6] + _ = x[AMXINT8-7] + _ = x[AMXTILE-8] + _ = x[AVX-9] + _ = x[AVX2-10] + _ = x[AVX512BF16-11] + _ = x[AVX512BITALG-12] + _ = x[AVX512BW-13] + _ = x[AVX512CD-14] + _ = x[AVX512DQ-15] + _ = x[AVX512ER-16] + _ = x[AVX512F-17] + _ = x[AVX512FP16-18] + _ = x[AVX512IFMA-19] + _ = x[AVX512PF-20] + _ = x[AVX512VBMI-21] + _ = x[AVX512VBMI2-22] + _ = x[AVX512VL-23] + _ = x[AVX512VNNI-24] + _ = x[AVX512VP2INTERSECT-25] + _ = x[AVX512VPOPCNTDQ-26] + _ = x[AVXIFMA-27] + _ = x[AVXNECONVERT-28] + _ = x[AVXSLOW-29] + _ = x[AVXVNNI-30] + _ = x[AVXVNNIINT8-31] + _ = x[BMI1-32] + _ = x[BMI2-33] + _ = x[CETIBT-34] + _ = x[CETSS-35] + _ = x[CLDEMOTE-36] + _ = x[CLMUL-37] + _ = x[CLZERO-38] + _ = x[CMOV-39] + _ = x[CMPCCXADD-40] + _ = x[CMPSB_SCADBS_SHORT-41] + _ = x[CMPXCHG8-42] + _ = x[CPBOOST-43] + _ = x[CPPC-44] + _ = x[CX16-45] + _ = x[EFER_LMSLE_UNS-46] + _ = x[ENQCMD-47] + _ = x[ERMS-48] + _ = x[F16C-49] + _ = x[FLUSH_L1D-50] + _ = x[FMA3-51] + _ = x[FMA4-52] + _ = x[FP128-53] + _ = x[FP256-54] + _ = x[FSRM-55] + _ = x[FXSR-56] + _ = x[FXSROPT-57] + _ = x[GFNI-58] + _ = x[HLE-59] + _ = x[HRESET-60] + _ = x[HTT-61] + _ = x[HWA-62] + _ = x[HYBRID_CPU-63] + _ = x[HYPERVISOR-64] + _ = x[IA32_ARCH_CAP-65] + _ = x[IA32_CORE_CAP-66] + _ = x[IBPB-67] + _ = x[IBRS-68] + _ = x[IBRS_PREFERRED-69] + _ = x[IBRS_PROVIDES_SMP-70] + _ = x[IBS-71] + _ = x[IBSBRNTRGT-72] + _ = x[IBSFETCHSAM-73] + _ = x[IBSFFV-74] + _ = x[IBSOPCNT-75] + _ = x[IBSOPCNTEXT-76] + _ = x[IBSOPSAM-77] + _ = x[IBSRDWROPCNT-78] + _ = x[IBSRIPINVALIDCHK-79] + _ = x[IBS_FETCH_CTLX-80] + _ = x[IBS_OPDATA4-81] + _ = x[IBS_OPFUSE-82] + _ = x[IBS_PREVENTHOST-83] + _ = x[IBS_ZEN4-84] + _ = x[INT_WBINVD-85] + _ = x[INVLPGB-86] + _ = x[LAHF-87] + _ = x[LAM-88] + _ = x[LBRVIRT-89] + _ = x[LZCNT-90] + _ = x[MCAOVERFLOW-91] + _ = x[MCDT_NO-92] + _ = x[MCOMMIT-93] + _ = x[MD_CLEAR-94] + _ = x[MMX-95] + _ = x[MMXEXT-96] + _ = x[MOVBE-97] + _ = x[MOVDIR64B-98] + _ = x[MOVDIRI-99] + _ = x[MOVSB_ZL-100] + _ = x[MOVU-101] + _ = x[MPX-102] + _ = x[MSRIRC-103] + _ = x[MSR_PAGEFLUSH-104] + _ = x[NRIPS-105] + _ = x[NX-106] + _ = x[OSXSAVE-107] + _ = x[PCONFIG-108] + _ = x[POPCNT-109] + _ = x[PPIN-110] + _ = x[PREFETCHI-111] + _ = x[PSFD-112] + _ = x[RDPRU-113] + _ = x[RDRAND-114] + _ = x[RDSEED-115] + _ = x[RDTSCP-116] + _ = x[RTM-117] + _ = x[RTM_ALWAYS_ABORT-118] + _ = x[SERIALIZE-119] + _ = x[SEV-120] + _ = x[SEV_64BIT-121] + _ = x[SEV_ALTERNATIVE-122] + _ = x[SEV_DEBUGSWAP-123] + _ = x[SEV_ES-124] + _ = x[SEV_RESTRICTED-125] + _ = x[SEV_SNP-126] + _ = x[SGX-127] + _ = x[SGXLC-128] + _ = x[SHA-129] + _ = x[SME-130] + _ = x[SME_COHERENT-131] + _ = x[SPEC_CTRL_SSBD-132] + _ = x[SRBDS_CTRL-133] + _ = x[SSE-134] + _ = x[SSE2-135] + _ = x[SSE3-136] + _ = x[SSE4-137] + _ = x[SSE42-138] + _ = x[SSE4A-139] + _ = x[SSSE3-140] + _ = x[STIBP-141] + _ = x[STIBP_ALWAYSON-142] + _ = x[STOSB_SHORT-143] + _ = x[SUCCOR-144] + _ = x[SVM-145] + _ = x[SVMDA-146] + _ = x[SVMFBASID-147] + _ = x[SVML-148] + _ = x[SVMNP-149] + _ = x[SVMPF-150] + _ = x[SVMPFT-151] + _ = x[SYSCALL-152] + _ = x[SYSEE-153] + _ = x[TBM-154] + _ = x[TLB_FLUSH_NESTED-155] + _ = x[TME-156] + _ = x[TOPEXT-157] + _ = x[TSCRATEMSR-158] + _ = x[TSXLDTRK-159] + _ = x[VAES-160] + _ = x[VMCBCLEAN-161] + _ = x[VMPL-162] + _ = x[VMSA_REGPROT-163] + _ = x[VMX-164] + _ = x[VPCLMULQDQ-165] + _ = x[VTE-166] + _ = x[WAITPKG-167] + _ = x[WBNOINVD-168] + _ = x[X87-169] + _ = x[XGETBV1-170] + _ = x[XOP-171] + _ = x[XSAVE-172] + _ = x[XSAVEC-173] + _ = x[XSAVEOPT-174] + _ = x[XSAVES-175] + _ = x[AESARM-176] + _ = x[ARMCPUID-177] + _ = x[ASIMD-178] + _ = x[ASIMDDP-179] + _ = x[ASIMDHP-180] + _ = x[ASIMDRDM-181] + _ = x[ATOMICS-182] + _ = x[CRC32-183] + _ = x[DCPOP-184] + _ = x[EVTSTRM-185] + _ = x[FCMA-186] + _ = x[FP-187] + _ = x[FPHP-188] + _ = x[GPA-189] + _ = x[JSCVT-190] + _ = x[LRCPC-191] + _ = x[PMULL-192] + _ = x[SHA1-193] + _ = x[SHA2-194] + _ = x[SHA3-195] + _ = x[SHA512-196] + _ = x[SM3-197] + _ = x[SM4-198] + _ = x[SVE-199] + _ = x[lastID-200] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKINT_WBINVDINVLPGBLAHFLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMPXMSRIRCNXOSXSAVEPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSCESERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSUCCORTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDX87XOPXSAVEAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4INT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 234, 238, 244, 249, 257, 262, 268, 272, 280, 287, 291, 297, 301, 305, 309, 313, 317, 324, 328, 331, 334, 337, 347, 351, 354, 364, 375, 381, 389, 400, 408, 420, 436, 446, 453, 457, 462, 473, 480, 483, 489, 494, 503, 510, 513, 519, 521, 528, 534, 539, 545, 551, 557, 560, 576, 579, 588, 591, 596, 599, 602, 606, 610, 614, 619, 624, 629, 634, 640, 643, 651, 655, 658, 668, 675, 683, 686, 689, 694, 700, 708, 713, 720, 727, 735, 742, 747, 752, 759, 763, 765, 769, 772, 777, 782, 787, 791, 795, 799, 805, 808, 811, 814, 820} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 278, 282, 288, 293, 301, 306, 312, 316, 325, 343, 351, 358, 362, 366, 380, 386, 390, 394, 403, 407, 411, 416, 421, 425, 429, 436, 440, 443, 449, 452, 455, 465, 475, 488, 501, 505, 509, 523, 540, 543, 553, 564, 570, 578, 589, 597, 609, 625, 639, 650, 660, 675, 683, 693, 700, 704, 707, 714, 719, 730, 737, 744, 752, 755, 761, 766, 775, 782, 790, 794, 797, 803, 816, 821, 823, 830, 837, 843, 847, 856, 860, 865, 871, 877, 883, 886, 902, 911, 914, 923, 938, 951, 957, 971, 978, 981, 986, 989, 992, 1004, 1018, 1028, 1031, 1035, 1039, 1043, 1048, 1053, 1058, 1063, 1077, 1088, 1094, 1097, 1102, 1111, 1115, 1120, 1125, 1131, 1138, 1143, 1146, 1162, 1165, 1171, 1181, 1189, 1193, 1202, 1206, 1218, 1221, 1231, 1234, 1241, 1249, 1252, 1259, 1262, 1267, 1273, 1281, 1287, 1293, 1301, 1306, 1313, 1320, 1328, 1335, 1340, 1345, 1352, 1356, 1358, 1362, 1365, 1370, 1375, 1380, 1384, 1388, 1392, 1398, 1401, 1404, 1407, 1413} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go index 8d2cb036..84b1acd2 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -2,18 +2,120 @@ package cpuid -import "runtime" +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } // There are no hw.optional sysctl values for the below features on Mac OS 11.0 // to detect their supported state dynamically. Assume the CPU features that // Apple Silicon M1 supports to be available as a minimal set of features // to all Go programs running on darwin/arm64. // TODO: Add more if we know them. c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) - c.PhysicalCores = runtime.NumCPU() - // For now assuming 1 thread per core... - c.ThreadsPerCore = 1 - c.LogicalCores = c.PhysicalCores + return true } + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/kyokomi/emoji/v2/emoji.go b/vendor/github.com/kyokomi/emoji/v2/emoji.go index 6913a2ea..245e2f0e 100644 --- a/vendor/github.com/kyokomi/emoji/v2/emoji.go +++ b/vendor/github.com/kyokomi/emoji/v2/emoji.go @@ -49,7 +49,8 @@ func NormalizeShortCode(shortCode string) string { // regular expression that matches :flag-[countrycode]: var flagRegexp = regexp.MustCompile(":flag-([a-z]{2}):") -func emojize(x string) string { +// Emojize Converts the string passed as an argument to a emoji. For unsupported emoji, the string passed as an argument is returned as is. +func Emojize(x string) string { str, ok := emojiCode()[x] if ok { return str + ReplacePadding @@ -83,7 +84,7 @@ func replaseEmoji(input *bytes.Buffer) string { case unicode.IsSpace(i): return emoji.String() case i == ':': - return emojize(emoji.String()) + return Emojize(emoji.String()) } } } diff --git a/vendor/github.com/labstack/echo/v4/.travis.yml b/vendor/github.com/labstack/echo/v4/.travis.yml deleted file mode 100644 index 67d45ad7..00000000 --- a/vendor/github.com/labstack/echo/v4/.travis.yml +++ /dev/null @@ -1,21 +0,0 @@ -arch: - - amd64 - - ppc64le - -language: go -go: - - 1.14.x - - 1.15.x - - tip -env: - - GO111MODULE=on -install: - - go get -v golang.org/x/lint/golint -script: - - golint -set_exit_status ./... - - go test -race -coverprofile=coverage.txt -covermode=atomic ./... -after_success: - - bash <(curl -s https://codecov.io/bash) -matrix: - allow_failures: - - go: tip diff --git a/vendor/github.com/labstack/echo/v4/CHANGELOG.md b/vendor/github.com/labstack/echo/v4/CHANGELOG.md index c1c3c107..83184249 100644 --- a/vendor/github.com/labstack/echo/v4/CHANGELOG.md +++ b/vendor/github.com/labstack/echo/v4/CHANGELOG.md @@ -1,5 +1,32 @@ # Changelog +## v4.10.2 - 2023-02-22 + +**Security** + +* `filepath.Clean` behaviour has changed in Go 1.20 - adapt to it [#2406](https://github.com/labstack/echo/pull/2406) +* Add `middleware.CORSConfig.UnsafeWildcardOriginWithAllowCredentials` to make UNSAFE usages of wildcard origin + allow cretentials less likely [#2405](https://github.com/labstack/echo/pull/2405) + +**Enhancements** + +* Add more HTTP error values [#2277](https://github.com/labstack/echo/pull/2277) + + +## v4.10.1 - 2023-02-19 + +**Security** + +* Upgrade deps due to the latest golang.org/x/net vulnerability [#2402](https://github.com/labstack/echo/pull/2402) + + +**Enhancements** + +* Add new JWT repository to the README [#2377](https://github.com/labstack/echo/pull/2377) +* Return an empty string for ctx.path if there is no registered path [#2385](https://github.com/labstack/echo/pull/2385) +* Add context timeout middleware [#2380](https://github.com/labstack/echo/pull/2380) +* Update link to jaegertracing [#2394](https://github.com/labstack/echo/pull/2394) + + ## v4.10.0 - 2022-12-27 **Security** diff --git a/vendor/github.com/labstack/echo/v4/README.md b/vendor/github.com/labstack/echo/v4/README.md index 509b9735..fe78b6ed 100644 --- a/vendor/github.com/labstack/echo/v4/README.md +++ b/vendor/github.com/labstack/echo/v4/README.md @@ -11,12 +11,12 @@ ## Supported Go versions -Latest version of Echo supports last four Go major [releases](https://go.dev/doc/devel/release) and might work with older versions. +Latest version of Echo supports last four Go major [releases](https://go.dev/doc/devel/release) and might work with +older versions. As of version 4.0.0, Echo is available as a [Go module](https://github.com/golang/go/wiki/Modules). Therefore a Go version capable of understanding /vN suffixed imports is required: - Any of these versions will allow you to import Echo as `github.com/labstack/echo/v4` which is the recommended way of using Echo going forward. @@ -90,18 +90,29 @@ func hello(c echo.Context) error { } ``` -# Third-party middlewares +# Official middleware repositories -| Repository | Description | -|------------------------------------------------------------------------------------------------------|----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| -| [github.com/labstack/echo-contrib](https://github.com/labstack/echo-contrib) | (by Echo team) [casbin](https://github.com/casbin/casbin), [gorilla/sessions](https://github.com/gorilla/sessions), [jaegertracing](github.com/uber/jaeger-client-go), [prometheus](https://github.com/prometheus/client_golang/), [pprof](https://pkg.go.dev/net/http/pprof), [zipkin](https://github.com/openzipkin/zipkin-go) middlewares | -| [deepmap/oapi-codegen](https://github.com/deepmap/oapi-codegen) | Automatically generate RESTful API documentation with [OpenAPI](https://swagger.io/specification/) Client and Server Code Generator | -| [github.com/swaggo/echo-swagger](https://github.com/swaggo/echo-swagger) | Automatically generate RESTful API documentation with [Swagger](https://swagger.io/) 2.0. | -| [github.com/ziflex/lecho](https://github.com/ziflex/lecho) | [Zerolog](https://github.com/rs/zerolog) logging library wrapper for Echo logger interface. | -| [github.com/brpaz/echozap](https://github.com/brpaz/echozap) | Uber´s [Zap](https://github.com/uber-go/zap) logging library wrapper for Echo logger interface. | -| [github.com/darkweak/souin/plugins/echo](https://github.com/darkweak/souin/tree/master/plugins/echo) | HTTP cache system based on [Souin](https://github.com/darkweak/souin) to automatically get your endpoints cached. It supports some distributed and non-distributed storage systems depending your needs. | -| [github.com/mikestefanello/pagoda](https://github.com/mikestefanello/pagoda) | Rapid, easy full-stack web development starter kit built with Echo. | -| [github.com/go-woo/protoc-gen-echo](https://github.com/go-woo/protoc-gen-echo) | ProtoBuf generate Echo server side code | +Following list of middleware is maintained by Echo team. + +| Repository | Description | +|------------------------------------------------------------------------------|-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| [github.com/labstack/echo-jwt](https://github.com/labstack/echo-jwt) | [JWT](https://github.com/golang-jwt/jwt) middleware | +| [github.com/labstack/echo-contrib](https://github.com/labstack/echo-contrib) | [casbin](https://github.com/casbin/casbin), [gorilla/sessions](https://github.com/gorilla/sessions), [jaegertracing](https://github.com/uber/jaeger-client-go), [prometheus](https://github.com/prometheus/client_golang/), [pprof](https://pkg.go.dev/net/http/pprof), [zipkin](https://github.com/openzipkin/zipkin-go) middlewares | + +# Third-party middleware repositories + +Be careful when adding 3rd party middleware. Echo teams does not have time or manpower to guarantee safety and quality +of middlewares in this list. + +| Repository | Description | +|------------------------------------------------------------------------------------------------------|----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| [deepmap/oapi-codegen](https://github.com/deepmap/oapi-codegen) | Automatically generate RESTful API documentation with [OpenAPI](https://swagger.io/specification/) Client and Server Code Generator | +| [github.com/swaggo/echo-swagger](https://github.com/swaggo/echo-swagger) | Automatically generate RESTful API documentation with [Swagger](https://swagger.io/) 2.0. | +| [github.com/ziflex/lecho](https://github.com/ziflex/lecho) | [Zerolog](https://github.com/rs/zerolog) logging library wrapper for Echo logger interface. | +| [github.com/brpaz/echozap](https://github.com/brpaz/echozap) | Uber´s [Zap](https://github.com/uber-go/zap) logging library wrapper for Echo logger interface. | +| [github.com/darkweak/souin/plugins/echo](https://github.com/darkweak/souin/tree/master/plugins/echo) | HTTP cache system based on [Souin](https://github.com/darkweak/souin) to automatically get your endpoints cached. It supports some distributed and non-distributed storage systems depending your needs. | +| [github.com/mikestefanello/pagoda](https://github.com/mikestefanello/pagoda) | Rapid, easy full-stack web development starter kit built with Echo. | +| [github.com/go-woo/protoc-gen-echo](https://github.com/go-woo/protoc-gen-echo) | ProtoBuf generate Echo server side code | Please send a PR to add your own library here. diff --git a/vendor/github.com/labstack/echo/v4/echo.go b/vendor/github.com/labstack/echo/v4/echo.go index f6d89b96..085a3a7f 100644 --- a/vendor/github.com/labstack/echo/v4/echo.go +++ b/vendor/github.com/labstack/echo/v4/echo.go @@ -258,7 +258,7 @@ const ( const ( // Version of Echo - Version = "4.10.0" + Version = "4.10.2" website = "https://echo.labstack.com" // http://patorjk.com/software/taag/#p=display&f=Small%20Slant&t=Echo banner = ` @@ -291,24 +291,53 @@ var ( // Errors var ( - ErrUnsupportedMediaType = NewHTTPError(http.StatusUnsupportedMediaType) - ErrNotFound = NewHTTPError(http.StatusNotFound) - ErrUnauthorized = NewHTTPError(http.StatusUnauthorized) - ErrForbidden = NewHTTPError(http.StatusForbidden) - ErrMethodNotAllowed = NewHTTPError(http.StatusMethodNotAllowed) - ErrStatusRequestEntityTooLarge = NewHTTPError(http.StatusRequestEntityTooLarge) - ErrTooManyRequests = NewHTTPError(http.StatusTooManyRequests) - ErrBadRequest = NewHTTPError(http.StatusBadRequest) - ErrBadGateway = NewHTTPError(http.StatusBadGateway) - ErrInternalServerError = NewHTTPError(http.StatusInternalServerError) - ErrRequestTimeout = NewHTTPError(http.StatusRequestTimeout) - ErrServiceUnavailable = NewHTTPError(http.StatusServiceUnavailable) - ErrValidatorNotRegistered = errors.New("validator not registered") - ErrRendererNotRegistered = errors.New("renderer not registered") - ErrInvalidRedirectCode = errors.New("invalid redirect status code") - ErrCookieNotFound = errors.New("cookie not found") - ErrInvalidCertOrKeyType = errors.New("invalid cert or key type, must be string or []byte") - ErrInvalidListenerNetwork = errors.New("invalid listener network") + ErrBadRequest = NewHTTPError(http.StatusBadRequest) // HTTP 400 Bad Request + ErrUnauthorized = NewHTTPError(http.StatusUnauthorized) // HTTP 401 Unauthorized + ErrPaymentRequired = NewHTTPError(http.StatusPaymentRequired) // HTTP 402 Payment Required + ErrForbidden = NewHTTPError(http.StatusForbidden) // HTTP 403 Forbidden + ErrNotFound = NewHTTPError(http.StatusNotFound) // HTTP 404 Not Found + ErrMethodNotAllowed = NewHTTPError(http.StatusMethodNotAllowed) // HTTP 405 Method Not Allowed + ErrNotAcceptable = NewHTTPError(http.StatusNotAcceptable) // HTTP 406 Not Acceptable + ErrProxyAuthRequired = NewHTTPError(http.StatusProxyAuthRequired) // HTTP 407 Proxy AuthRequired + ErrRequestTimeout = NewHTTPError(http.StatusRequestTimeout) // HTTP 408 Request Timeout + ErrConflict = NewHTTPError(http.StatusConflict) // HTTP 409 Conflict + ErrGone = NewHTTPError(http.StatusGone) // HTTP 410 Gone + ErrLengthRequired = NewHTTPError(http.StatusLengthRequired) // HTTP 411 Length Required + ErrPreconditionFailed = NewHTTPError(http.StatusPreconditionFailed) // HTTP 412 Precondition Failed + ErrStatusRequestEntityTooLarge = NewHTTPError(http.StatusRequestEntityTooLarge) // HTTP 413 Payload Too Large + ErrRequestURITooLong = NewHTTPError(http.StatusRequestURITooLong) // HTTP 414 URI Too Long + ErrUnsupportedMediaType = NewHTTPError(http.StatusUnsupportedMediaType) // HTTP 415 Unsupported Media Type + ErrRequestedRangeNotSatisfiable = NewHTTPError(http.StatusRequestedRangeNotSatisfiable) // HTTP 416 Range Not Satisfiable + ErrExpectationFailed = NewHTTPError(http.StatusExpectationFailed) // HTTP 417 Expectation Failed + ErrTeapot = NewHTTPError(http.StatusTeapot) // HTTP 418 I'm a teapot + ErrMisdirectedRequest = NewHTTPError(http.StatusMisdirectedRequest) // HTTP 421 Misdirected Request + ErrUnprocessableEntity = NewHTTPError(http.StatusUnprocessableEntity) // HTTP 422 Unprocessable Entity + ErrLocked = NewHTTPError(http.StatusLocked) // HTTP 423 Locked + ErrFailedDependency = NewHTTPError(http.StatusFailedDependency) // HTTP 424 Failed Dependency + ErrTooEarly = NewHTTPError(http.StatusTooEarly) // HTTP 425 Too Early + ErrUpgradeRequired = NewHTTPError(http.StatusUpgradeRequired) // HTTP 426 Upgrade Required + ErrPreconditionRequired = NewHTTPError(http.StatusPreconditionRequired) // HTTP 428 Precondition Required + ErrTooManyRequests = NewHTTPError(http.StatusTooManyRequests) // HTTP 429 Too Many Requests + ErrRequestHeaderFieldsTooLarge = NewHTTPError(http.StatusRequestHeaderFieldsTooLarge) // HTTP 431 Request Header Fields Too Large + ErrUnavailableForLegalReasons = NewHTTPError(http.StatusUnavailableForLegalReasons) // HTTP 451 Unavailable For Legal Reasons + ErrInternalServerError = NewHTTPError(http.StatusInternalServerError) // HTTP 500 Internal Server Error + ErrNotImplemented = NewHTTPError(http.StatusNotImplemented) // HTTP 501 Not Implemented + ErrBadGateway = NewHTTPError(http.StatusBadGateway) // HTTP 502 Bad Gateway + ErrServiceUnavailable = NewHTTPError(http.StatusServiceUnavailable) // HTTP 503 Service Unavailable + ErrGatewayTimeout = NewHTTPError(http.StatusGatewayTimeout) // HTTP 504 Gateway Timeout + ErrHTTPVersionNotSupported = NewHTTPError(http.StatusHTTPVersionNotSupported) // HTTP 505 HTTP Version Not Supported + ErrVariantAlsoNegotiates = NewHTTPError(http.StatusVariantAlsoNegotiates) // HTTP 506 Variant Also Negotiates + ErrInsufficientStorage = NewHTTPError(http.StatusInsufficientStorage) // HTTP 507 Insufficient Storage + ErrLoopDetected = NewHTTPError(http.StatusLoopDetected) // HTTP 508 Loop Detected + ErrNotExtended = NewHTTPError(http.StatusNotExtended) // HTTP 510 Not Extended + ErrNetworkAuthenticationRequired = NewHTTPError(http.StatusNetworkAuthenticationRequired) // HTTP 511 Network Authentication Required + + ErrValidatorNotRegistered = errors.New("validator not registered") + ErrRendererNotRegistered = errors.New("renderer not registered") + ErrInvalidRedirectCode = errors.New("invalid redirect status code") + ErrCookieNotFound = errors.New("cookie not found") + ErrInvalidCertOrKeyType = errors.New("invalid cert or key type, must be string or []byte") + ErrInvalidListenerNetwork = errors.New("invalid listener network") ) // Error handlers diff --git a/vendor/github.com/labstack/echo/v4/middleware/context_timeout.go b/vendor/github.com/labstack/echo/v4/middleware/context_timeout.go new file mode 100644 index 00000000..be260e18 --- /dev/null +++ b/vendor/github.com/labstack/echo/v4/middleware/context_timeout.go @@ -0,0 +1,72 @@ +package middleware + +import ( + "context" + "errors" + "time" + + "github.com/labstack/echo/v4" +) + +// ContextTimeoutConfig defines the config for ContextTimeout middleware. +type ContextTimeoutConfig struct { + // Skipper defines a function to skip middleware. + Skipper Skipper + + // ErrorHandler is a function when error aries in middeware execution. + ErrorHandler func(err error, c echo.Context) error + + // Timeout configures a timeout for the middleware, defaults to 0 for no timeout + Timeout time.Duration +} + +// ContextTimeout returns a middleware which returns error (503 Service Unavailable error) to client +// when underlying method returns context.DeadlineExceeded error. +func ContextTimeout(timeout time.Duration) echo.MiddlewareFunc { + return ContextTimeoutWithConfig(ContextTimeoutConfig{Timeout: timeout}) +} + +// ContextTimeoutWithConfig returns a Timeout middleware with config. +func ContextTimeoutWithConfig(config ContextTimeoutConfig) echo.MiddlewareFunc { + mw, err := config.ToMiddleware() + if err != nil { + panic(err) + } + return mw +} + +// ToMiddleware converts Config to middleware. +func (config ContextTimeoutConfig) ToMiddleware() (echo.MiddlewareFunc, error) { + if config.Timeout == 0 { + return nil, errors.New("timeout must be set") + } + if config.Skipper == nil { + config.Skipper = DefaultSkipper + } + if config.ErrorHandler == nil { + config.ErrorHandler = func(err error, c echo.Context) error { + if err != nil && errors.Is(err, context.DeadlineExceeded) { + return echo.ErrServiceUnavailable.WithInternal(err) + } + return err + } + } + + return func(next echo.HandlerFunc) echo.HandlerFunc { + return func(c echo.Context) error { + if config.Skipper(c) { + return next(c) + } + + timeoutContext, cancel := context.WithTimeout(c.Request().Context(), config.Timeout) + defer cancel() + + c.SetRequest(c.Request().WithContext(timeoutContext)) + + if err := next(c); err != nil { + return config.ErrorHandler(err, c) + } + return nil + } + }, nil +} diff --git a/vendor/github.com/labstack/echo/v4/middleware/cors.go b/vendor/github.com/labstack/echo/v4/middleware/cors.go index 25cf983a..149de347 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/cors.go +++ b/vendor/github.com/labstack/echo/v4/middleware/cors.go @@ -79,6 +79,15 @@ type ( // See also: https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/Access-Control-Allow-Credentials AllowCredentials bool `yaml:"allow_credentials"` + // UnsafeWildcardOriginWithAllowCredentials UNSAFE/INSECURE: allows wildcard '*' origin to be used with AllowCredentials + // flag. In that case we consider any origin allowed and send it back to the client with `Access-Control-Allow-Origin` header. + // + // This is INSECURE and potentially leads to [cross-origin](https://portswigger.net/research/exploiting-cors-misconfigurations-for-bitcoins-and-bounties) + // attacks. See: https://github.com/labstack/echo/issues/2400 for discussion on the subject. + // + // Optional. Default value is false. + UnsafeWildcardOriginWithAllowCredentials bool `yaml:"unsafe_wildcard_origin_with_allow_credentials"` + // ExposeHeaders determines the value of Access-Control-Expose-Headers, which // defines a list of headers that clients are allowed to access. // @@ -203,7 +212,7 @@ func CORSWithConfig(config CORSConfig) echo.MiddlewareFunc { } else { // Check allowed origins for _, o := range config.AllowOrigins { - if o == "*" && config.AllowCredentials { + if o == "*" && config.AllowCredentials && config.UnsafeWildcardOriginWithAllowCredentials { allowOrigin = origin break } diff --git a/vendor/github.com/labstack/echo/v4/middleware/csrf.go b/vendor/github.com/labstack/echo/v4/middleware/csrf.go index 8661c9f8..6899700c 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/csrf.go +++ b/vendor/github.com/labstack/echo/v4/middleware/csrf.go @@ -119,9 +119,9 @@ func CSRFWithConfig(config CSRFConfig) echo.MiddlewareFunc { config.CookieSecure = true } - extractors, err := CreateExtractors(config.TokenLookup) - if err != nil { - panic(err) + extractors, cErr := CreateExtractors(config.TokenLookup) + if cErr != nil { + panic(cErr) } return func(next echo.HandlerFunc) echo.HandlerFunc { diff --git a/vendor/github.com/labstack/echo/v4/middleware/jwt.go b/vendor/github.com/labstack/echo/v4/middleware/jwt.go index bd628264..bc318c97 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/jwt.go +++ b/vendor/github.com/labstack/echo/v4/middleware/jwt.go @@ -196,9 +196,9 @@ func JWTWithConfig(config JWTConfig) echo.MiddlewareFunc { config.ParseTokenFunc = config.defaultParseToken } - extractors, err := createExtractors(config.TokenLookup, config.AuthScheme) - if err != nil { - panic(err) + extractors, cErr := createExtractors(config.TokenLookup, config.AuthScheme) + if cErr != nil { + panic(cErr) } if len(config.TokenLookupFuncs) > 0 { extractors = append(config.TokenLookupFuncs, extractors...) diff --git a/vendor/github.com/labstack/echo/v4/middleware/key_auth.go b/vendor/github.com/labstack/echo/v4/middleware/key_auth.go index e8a6b085..f6fcc5d6 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/key_auth.go +++ b/vendor/github.com/labstack/echo/v4/middleware/key_auth.go @@ -108,9 +108,9 @@ func KeyAuthWithConfig(config KeyAuthConfig) echo.MiddlewareFunc { panic("echo: key-auth middleware requires a validator function") } - extractors, err := createExtractors(config.KeyLookup, config.AuthScheme) - if err != nil { - panic(err) + extractors, cErr := createExtractors(config.KeyLookup, config.AuthScheme) + if cErr != nil { + panic(cErr) } return func(next echo.HandlerFunc) echo.HandlerFunc { diff --git a/vendor/github.com/labstack/echo/v4/middleware/static.go b/vendor/github.com/labstack/echo/v4/middleware/static.go index 27ccf411..24a5f59b 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/static.go +++ b/vendor/github.com/labstack/echo/v4/middleware/static.go @@ -8,7 +8,6 @@ import ( "net/url" "os" "path" - "path/filepath" "strings" "github.com/labstack/echo/v4" @@ -157,9 +156,9 @@ func StaticWithConfig(config StaticConfig) echo.MiddlewareFunc { } // Index template - t, err := template.New("index").Parse(html) - if err != nil { - panic(fmt.Sprintf("echo: %v", err)) + t, tErr := template.New("index").Parse(html) + if tErr != nil { + panic(fmt.Errorf("echo: %w", tErr)) } return func(next echo.HandlerFunc) echo.HandlerFunc { @@ -176,7 +175,7 @@ func StaticWithConfig(config StaticConfig) echo.MiddlewareFunc { if err != nil { return } - name := filepath.Join(config.Root, filepath.Clean("/"+p)) // "/"+ for security + name := path.Join(config.Root, path.Clean("/"+p)) // "/"+ for security if config.IgnoreBase { routePath := path.Base(strings.TrimRight(c.Path(), "/*")) @@ -187,12 +186,14 @@ func StaticWithConfig(config StaticConfig) echo.MiddlewareFunc { } } - file, err := openFile(config.Filesystem, name) + file, err := config.Filesystem.Open(name) if err != nil { - if !os.IsNotExist(err) { + if !isIgnorableOpenFileError(err) { return err } + // file with that path did not exist, so we continue down in middleware/handler chain, hoping that we end up in + // handler that is meant to handle this request if err = next(c); err == nil { return err } @@ -202,7 +203,7 @@ func StaticWithConfig(config StaticConfig) echo.MiddlewareFunc { return err } - file, err = openFile(config.Filesystem, filepath.Join(config.Root, config.Index)) + file, err = config.Filesystem.Open(path.Join(config.Root, config.Index)) if err != nil { return err } @@ -216,15 +217,13 @@ func StaticWithConfig(config StaticConfig) echo.MiddlewareFunc { } if info.IsDir() { - index, err := openFile(config.Filesystem, filepath.Join(name, config.Index)) + index, err := config.Filesystem.Open(path.Join(name, config.Index)) if err != nil { if config.Browse { return listDir(t, name, file, c.Response()) } - if os.IsNotExist(err) { - return next(c) - } + return next(c) } defer index.Close() @@ -242,11 +241,6 @@ func StaticWithConfig(config StaticConfig) echo.MiddlewareFunc { } } -func openFile(fs http.FileSystem, name string) (http.File, error) { - pathWithSlashes := filepath.ToSlash(name) - return fs.Open(pathWithSlashes) -} - func serveFile(c echo.Context, file http.File, info os.FileInfo) error { http.ServeContent(c.Response(), c.Request(), info.Name(), info.ModTime(), file) return nil diff --git a/vendor/github.com/labstack/echo/v4/middleware/static_other.go b/vendor/github.com/labstack/echo/v4/middleware/static_other.go new file mode 100644 index 00000000..0337b22a --- /dev/null +++ b/vendor/github.com/labstack/echo/v4/middleware/static_other.go @@ -0,0 +1,12 @@ +//go:build !windows + +package middleware + +import ( + "os" +) + +// We ignore these errors as there could be handler that matches request path. +func isIgnorableOpenFileError(err error) bool { + return os.IsNotExist(err) +} diff --git a/vendor/github.com/labstack/echo/v4/middleware/static_windows.go b/vendor/github.com/labstack/echo/v4/middleware/static_windows.go new file mode 100644 index 00000000..0ab11985 --- /dev/null +++ b/vendor/github.com/labstack/echo/v4/middleware/static_windows.go @@ -0,0 +1,23 @@ +package middleware + +import ( + "os" +) + +// We ignore these errors as there could be handler that matches request path. +// +// As of Go 1.20 filepath.Clean has different behaviour on OS related filesystems so we need to use path.Clean +// on Windows which has some caveats. The Open methods might return different errors than earlier versions and +// as of 1.20 path checks are more strict on the provided path and considers [UNC](https://en.wikipedia.org/wiki/Path_(computing)#UNC) +// paths with missing host etc parts as invalid. Previously it would result you `fs.ErrNotExist`. +// +// For 1.20@Windows we need to treat those errors the same as `fs.ErrNotExists` so we can continue handling +// errors in the middleware/handler chain. Otherwise we might end up with status 500 instead of finding a route +// or return 404 not found. +func isIgnorableOpenFileError(err error) bool { + if os.IsNotExist(err) { + return true + } + errTxt := err.Error() + return errTxt == "http: invalid or unsafe file path" || errTxt == "invalid path" +} diff --git a/vendor/github.com/labstack/echo/v4/router.go b/vendor/github.com/labstack/echo/v4/router.go index 86a986a2..597660d3 100644 --- a/vendor/github.com/labstack/echo/v4/router.go +++ b/vendor/github.com/labstack/echo/v4/router.go @@ -524,7 +524,6 @@ func optionsMethodHandler(allowMethods string) func(c Context) error { // - Return it `Echo#ReleaseContext()`. func (r *Router) Find(method, path string, c Context) { ctx := c.(*context) - ctx.path = path currentNode := r.tree // Current node as root var ( diff --git a/vendor/github.com/matterbridge/matterclient/channels.go b/vendor/github.com/matterbridge/matterclient/channels.go index 6bf22a68..c1facf8b 100644 --- a/vendor/github.com/matterbridge/matterclient/channels.go +++ b/vendor/github.com/matterbridge/matterclient/channels.go @@ -80,7 +80,14 @@ func (m *Client) getChannelIDTeam(name string, teamID string) string { } } - return "" + // Fallback if it's not found in the t.Channels or t.MoreChannels cache. + // This also let's us join private channels. + channel, _, err := m.Client.GetChannelByName(name, teamID, "") + if err != nil { + return "" + } + + return channel.Id } func (m *Client) GetChannelName(channelID string) string { @@ -224,8 +231,13 @@ func (m *Client) UpdateChannelsTeam(teamID string) error { } } + idx := 0 + max := 200 + + var moreChannels []*model.Channel + for { - mmchannels, resp, err = m.Client.GetPublicChannelsForTeam(teamID, 0, 5000, "") + mmchannels, resp, err = m.Client.GetPublicChannelsForTeam(teamID, idx, max, "") if err == nil { break } @@ -235,10 +247,27 @@ func (m *Client) UpdateChannelsTeam(teamID string) error { } } + for len(mmchannels) > 0 { + moreChannels = append(moreChannels, mmchannels...) + + for { + mmchannels, resp, err = m.Client.GetPublicChannelsForTeam(teamID, idx, max, "") + if err == nil { + idx++ + + break + } + + if err := m.HandleRatelimit("GetPublicChannelsForTeam", resp); err != nil { + return err + } + } + } + for idx, t := range m.OtherTeams { if t.ID == teamID { m.Lock() - m.OtherTeams[idx].MoreChannels = mmchannels + m.OtherTeams[idx].MoreChannels = moreChannels m.Unlock() } } @@ -252,6 +281,10 @@ func (m *Client) UpdateChannels() error { } for _, t := range m.OtherTeams { + // We've already populated users/channels for team in the above. + if t.ID == m.Team.ID { + continue + } if err := m.UpdateChannelsTeam(t.ID); err != nil { return err } diff --git a/vendor/github.com/matterbridge/matterclient/matterclient.go b/vendor/github.com/matterbridge/matterclient/matterclient.go index 0652fe73..fe845efc 100644 --- a/vendor/github.com/matterbridge/matterclient/matterclient.go +++ b/vendor/github.com/matterbridge/matterclient/matterclient.go @@ -144,6 +144,10 @@ func (m *Client) Login() error { return err } + if err := m.initUserChannels(); err != nil { + return err + } + if m.Team == nil { validTeamNames := make([]string, len(m.OtherTeams)) for i, t := range m.OtherTeams { @@ -332,8 +336,11 @@ func (m *Client) initUser() error { time.Sleep(time.Millisecond * 200) } - - m.logger.Infof("found %d users in team %s", len(usermap), team.Name) + m.logger.Debugf("found %d users in team %s", len(usermap), team.Name) + // add all users + for k, v := range usermap { + m.Users[k] = v + } t := &Team{ Team: team, @@ -341,29 +348,25 @@ func (m *Client) initUser() error { ID: team.Id, } - mmchannels, _, err := m.Client.GetChannelsForTeamForUser(team.Id, m.User.Id, false, "") - if err != nil { - return err - } - - t.Channels = mmchannels - - mmchannels, _, err = m.Client.GetPublicChannelsForTeam(team.Id, 0, 5000, "") - if err != nil { - return err - } - - t.MoreChannels = mmchannels m.OtherTeams = append(m.OtherTeams, t) if team.Name == m.Credentials.Team { m.Team = t m.logger.Debugf("initUser(): found our team %s (id: %s)", team.Name, team.Id) } - // add all users - for k, v := range t.Users { - m.Users[k] = v - } + } + + return nil +} + +func (m *Client) initUserChannels() error { + if err := m.UpdateChannels(); err != nil { + return err + } + + for _, t := range m.OtherTeams { + m.logger.Debugf("found %d channels for user in team %s", len(t.Channels), t.Team.Name) + m.logger.Debugf("found %d public channels in team %s", len(t.MoreChannels), t.Team.Name) } return nil diff --git a/vendor/github.com/mattn/go-isatty/isatty_bsd.go b/vendor/github.com/mattn/go-isatty/isatty_bsd.go index 39bbcf00..d569c0c9 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_bsd.go +++ b/vendor/github.com/mattn/go-isatty/isatty_bsd.go @@ -1,5 +1,5 @@ -//go:build (darwin || freebsd || openbsd || netbsd || dragonfly) && !appengine -// +build darwin freebsd openbsd netbsd dragonfly +//go:build (darwin || freebsd || openbsd || netbsd || dragonfly || hurd) && !appengine +// +build darwin freebsd openbsd netbsd dragonfly hurd // +build !appengine package isatty diff --git a/vendor/github.com/remyoudompheng/bigfft/README b/vendor/github.com/remyoudompheng/bigfft/README index 303c6177..0fcd39d9 100644 --- a/vendor/github.com/remyoudompheng/bigfft/README +++ b/vendor/github.com/remyoudompheng/bigfft/README @@ -1,3 +1,14 @@ +This library is a toy proof-of-concept implementation of the +well-known Schonhage-Strassen method for multiplying integers. +It is not expected to have a real life usecase outside number +theory computations, nor is it expected to be used in any production +system. + +If you are using it in your project, you may want to carefully +examine the actual requirement or problem you are trying to solve. + +# Comparison with the standard library and GMP + Benchmarking math/big vs. bigfft Number size old ns/op new ns/op delta diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_386.s b/vendor/github.com/remyoudompheng/bigfft/arith_386.s deleted file mode 100644 index cc50a017..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_386.s +++ /dev/null @@ -1,36 +0,0 @@ -// Trampolines to math/big assembly implementations. - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - JMP math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -TEXT ·subVV(SB),NOSPLIT,$0 - JMP math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - JMP math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -TEXT ·subVW(SB),NOSPLIT,$0 - JMP math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - JMP math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - JMP math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - JMP math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - JMP math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_amd64.s b/vendor/github.com/remyoudompheng/bigfft/arith_amd64.s deleted file mode 100644 index 0b79335f..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_amd64.s +++ /dev/null @@ -1,38 +0,0 @@ -// Trampolines to math/big assembly implementations. - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - JMP math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -// (same as addVV except for SBBQ instead of ADCQ and label names) -TEXT ·subVV(SB),NOSPLIT,$0 - JMP math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - JMP math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -// (same as addVW except for SUBQ/SBBQ instead of ADDQ/ADCQ and label names) -TEXT ·subVW(SB),NOSPLIT,$0 - JMP math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - JMP math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - JMP math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - JMP math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - JMP math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_arm.s b/vendor/github.com/remyoudompheng/bigfft/arith_arm.s deleted file mode 100644 index 0ed60f5c..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_arm.s +++ /dev/null @@ -1,36 +0,0 @@ -// Trampolines to math/big assembly implementations. - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - B math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -TEXT ·subVV(SB),NOSPLIT,$0 - B math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - B math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -TEXT ·subVW(SB),NOSPLIT,$0 - B math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - B math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - B math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - B math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - B math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_arm64.s b/vendor/github.com/remyoudompheng/bigfft/arith_arm64.s deleted file mode 100644 index 0ed60f5c..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_arm64.s +++ /dev/null @@ -1,36 +0,0 @@ -// Trampolines to math/big assembly implementations. - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - B math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -TEXT ·subVV(SB),NOSPLIT,$0 - B math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - B math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -TEXT ·subVW(SB),NOSPLIT,$0 - B math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - B math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - B math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - B math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - B math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_decl.go b/vendor/github.com/remyoudompheng/bigfft/arith_decl.go index 7659b019..96937dff 100644 --- a/vendor/github.com/remyoudompheng/bigfft/arith_decl.go +++ b/vendor/github.com/remyoudompheng/bigfft/arith_decl.go @@ -4,13 +4,30 @@ package bigfft -import . "math/big" +import ( + "math/big" + _ "unsafe" +) -// implemented in arith_$GOARCH.s +type Word = big.Word + +//go:linkname addVV math/big.addVV func addVV(z, x, y []Word) (c Word) + +//go:linkname subVV math/big.subVV func subVV(z, x, y []Word) (c Word) + +//go:linkname addVW math/big.addVW func addVW(z, x []Word, y Word) (c Word) + +//go:linkname subVW math/big.subVW func subVW(z, x []Word, y Word) (c Word) + +//go:linkname shlVU math/big.shlVU func shlVU(z, x []Word, s uint) (c Word) + +//go:linkname mulAddVWW math/big.mulAddVWW func mulAddVWW(z, x []Word, y, r Word) (c Word) + +//go:linkname addMulVVW math/big.addMulVVW func addMulVVW(z, x []Word, y Word) (c Word) diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_mips64x.s b/vendor/github.com/remyoudompheng/bigfft/arith_mips64x.s deleted file mode 100644 index 82443882..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_mips64x.s +++ /dev/null @@ -1,40 +0,0 @@ -// Trampolines to math/big assembly implementations. - -// +build mips64 mips64le - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - JMP math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -// (same as addVV except for SBBQ instead of ADCQ and label names) -TEXT ·subVV(SB),NOSPLIT,$0 - JMP math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - JMP math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -// (same as addVW except for SUBQ/SBBQ instead of ADDQ/ADCQ and label names) -TEXT ·subVW(SB),NOSPLIT,$0 - JMP math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - JMP math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - JMP math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - JMP math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - JMP math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_mipsx.s b/vendor/github.com/remyoudompheng/bigfft/arith_mipsx.s deleted file mode 100644 index 6c0e92e5..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_mipsx.s +++ /dev/null @@ -1,40 +0,0 @@ -// Trampolines to math/big assembly implementations. - -// +build mips mipsle - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - JMP math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -// (same as addVV except for SBBQ instead of ADCQ and label names) -TEXT ·subVV(SB),NOSPLIT,$0 - JMP math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - JMP math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -// (same as addVW except for SUBQ/SBBQ instead of ADDQ/ADCQ and label names) -TEXT ·subVW(SB),NOSPLIT,$0 - JMP math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - JMP math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - JMP math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - JMP math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - JMP math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_ppc64x.s b/vendor/github.com/remyoudompheng/bigfft/arith_ppc64x.s deleted file mode 100644 index 16c7f153..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_ppc64x.s +++ /dev/null @@ -1,38 +0,0 @@ -// Trampolines to math/big assembly implementations. - -// +build ppc64 ppc64le - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - BR math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -TEXT ·subVV(SB),NOSPLIT,$0 - BR math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - BR math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -TEXT ·subVW(SB),NOSPLIT,$0 - BR math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - BR math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - BR math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - BR math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - BR math∕big·addMulVVW(SB) - diff --git a/vendor/github.com/remyoudompheng/bigfft/arith_s390x.s b/vendor/github.com/remyoudompheng/bigfft/arith_s390x.s deleted file mode 100644 index f72ab053..00000000 --- a/vendor/github.com/remyoudompheng/bigfft/arith_s390x.s +++ /dev/null @@ -1,37 +0,0 @@ - -// Trampolines to math/big assembly implementations. - -#include "textflag.h" - -// func addVV(z, x, y []Word) (c Word) -TEXT ·addVV(SB),NOSPLIT,$0 - BR math∕big·addVV(SB) - -// func subVV(z, x, y []Word) (c Word) -TEXT ·subVV(SB),NOSPLIT,$0 - BR math∕big·subVV(SB) - -// func addVW(z, x []Word, y Word) (c Word) -TEXT ·addVW(SB),NOSPLIT,$0 - BR math∕big·addVW(SB) - -// func subVW(z, x []Word, y Word) (c Word) -TEXT ·subVW(SB),NOSPLIT,$0 - BR math∕big·subVW(SB) - -// func shlVU(z, x []Word, s uint) (c Word) -TEXT ·shlVU(SB),NOSPLIT,$0 - BR math∕big·shlVU(SB) - -// func shrVU(z, x []Word, s uint) (c Word) -TEXT ·shrVU(SB),NOSPLIT,$0 - BR math∕big·shrVU(SB) - -// func mulAddVWW(z, x []Word, y, r Word) (c Word) -TEXT ·mulAddVWW(SB),NOSPLIT,$0 - BR math∕big·mulAddVWW(SB) - -// func addMulVVW(z, x []Word, y Word) (c Word) -TEXT ·addMulVVW(SB),NOSPLIT,$0 - BR math∕big·addMulVVW(SB) - diff --git a/vendor/go.mau.fi/whatsmeow/appstate.go b/vendor/go.mau.fi/whatsmeow/appstate.go index 7e99b513..7493a030 100644 --- a/vendor/go.mau.fi/whatsmeow/appstate.go +++ b/vendor/go.mau.fi/whatsmeow/appstate.go @@ -271,7 +271,7 @@ func (cli *Client) requestAppStateKeys(ctx context.Context, rawKeyIDs [][]byte) }, } ownID := cli.getOwnID().ToNonAD() - if ownID.IsEmpty() { + if ownID.IsEmpty() || len(debugKeyIDs) == 0 { return } cli.Log.Infof("Sending key request for app state keys %+v", debugKeyIDs) diff --git a/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.go b/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.go index 046bebe2..16a9928c 100644 --- a/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.go +++ b/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.go @@ -22,65 +22,6 @@ const ( _ = protoimpl.EnforceVersion(protoimpl.MaxVersion - 20) ) -type PeerDataOperationRequestType int32 - -const ( - PeerDataOperationRequestType_UPLOAD_STICKER PeerDataOperationRequestType = 0 - PeerDataOperationRequestType_SEND_RECENT_STICKER_BOOTSTRAP PeerDataOperationRequestType = 1 - PeerDataOperationRequestType_GENERATE_LINK_PREVIEW PeerDataOperationRequestType = 2 -) - -// Enum value maps for PeerDataOperationRequestType. -var ( - PeerDataOperationRequestType_name = map[int32]string{ - 0: "UPLOAD_STICKER", - 1: "SEND_RECENT_STICKER_BOOTSTRAP", - 2: "GENERATE_LINK_PREVIEW", - } - PeerDataOperationRequestType_value = map[string]int32{ - "UPLOAD_STICKER": 0, - "SEND_RECENT_STICKER_BOOTSTRAP": 1, - "GENERATE_LINK_PREVIEW": 2, - } -) - -func (x PeerDataOperationRequestType) Enum() *PeerDataOperationRequestType { - p := new(PeerDataOperationRequestType) - *p = x - return p -} - -func (x PeerDataOperationRequestType) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (PeerDataOperationRequestType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[0].Descriptor() -} - -func (PeerDataOperationRequestType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[0] -} - -func (x PeerDataOperationRequestType) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Do not use. -func (x *PeerDataOperationRequestType) UnmarshalJSON(b []byte) error { - num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) - if err != nil { - return err - } - *x = PeerDataOperationRequestType(num) - return nil -} - -// Deprecated: Use PeerDataOperationRequestType.Descriptor instead. -func (PeerDataOperationRequestType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{0} -} - type KeepType int32 const ( @@ -114,11 +55,11 @@ func (x KeepType) String() string { } func (KeepType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[1].Descriptor() + return file_binary_proto_def_proto_enumTypes[0].Descriptor() } func (KeepType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[1] + return &file_binary_proto_def_proto_enumTypes[0] } func (x KeepType) Number() protoreflect.EnumNumber { @@ -137,6 +78,68 @@ func (x *KeepType) UnmarshalJSON(b []byte) error { // Deprecated: Use KeepType.Descriptor instead. func (KeepType) EnumDescriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{0} +} + +type PeerDataOperationRequestType int32 + +const ( + PeerDataOperationRequestType_UPLOAD_STICKER PeerDataOperationRequestType = 0 + PeerDataOperationRequestType_SEND_RECENT_STICKER_BOOTSTRAP PeerDataOperationRequestType = 1 + PeerDataOperationRequestType_GENERATE_LINK_PREVIEW PeerDataOperationRequestType = 2 + PeerDataOperationRequestType_HISTORY_SYNC_ON_DEMAND PeerDataOperationRequestType = 3 +) + +// Enum value maps for PeerDataOperationRequestType. +var ( + PeerDataOperationRequestType_name = map[int32]string{ + 0: "UPLOAD_STICKER", + 1: "SEND_RECENT_STICKER_BOOTSTRAP", + 2: "GENERATE_LINK_PREVIEW", + 3: "HISTORY_SYNC_ON_DEMAND", + } + PeerDataOperationRequestType_value = map[string]int32{ + "UPLOAD_STICKER": 0, + "SEND_RECENT_STICKER_BOOTSTRAP": 1, + "GENERATE_LINK_PREVIEW": 2, + "HISTORY_SYNC_ON_DEMAND": 3, + } +) + +func (x PeerDataOperationRequestType) Enum() *PeerDataOperationRequestType { + p := new(PeerDataOperationRequestType) + *p = x + return p +} + +func (x PeerDataOperationRequestType) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (PeerDataOperationRequestType) Descriptor() protoreflect.EnumDescriptor { + return file_binary_proto_def_proto_enumTypes[1].Descriptor() +} + +func (PeerDataOperationRequestType) Type() protoreflect.EnumType { + return &file_binary_proto_def_proto_enumTypes[1] +} + +func (x PeerDataOperationRequestType) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *PeerDataOperationRequestType) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = PeerDataOperationRequestType(num) + return nil +} + +// Deprecated: Use PeerDataOperationRequestType.Descriptor instead. +func (PeerDataOperationRequestType) EnumDescriptor() ([]byte, []int) { return file_binary_proto_def_proto_rawDescGZIP(), []int{1} } @@ -202,20 +205,24 @@ func (MediaVisibility) EnumDescriptor() ([]byte, []int) { type DeviceProps_PlatformType int32 const ( - DeviceProps_UNKNOWN DeviceProps_PlatformType = 0 - DeviceProps_CHROME DeviceProps_PlatformType = 1 - DeviceProps_FIREFOX DeviceProps_PlatformType = 2 - DeviceProps_IE DeviceProps_PlatformType = 3 - DeviceProps_OPERA DeviceProps_PlatformType = 4 - DeviceProps_SAFARI DeviceProps_PlatformType = 5 - DeviceProps_EDGE DeviceProps_PlatformType = 6 - DeviceProps_DESKTOP DeviceProps_PlatformType = 7 - DeviceProps_IPAD DeviceProps_PlatformType = 8 - DeviceProps_ANDROID_TABLET DeviceProps_PlatformType = 9 - DeviceProps_OHANA DeviceProps_PlatformType = 10 - DeviceProps_ALOHA DeviceProps_PlatformType = 11 - DeviceProps_CATALINA DeviceProps_PlatformType = 12 - DeviceProps_TCL_TV DeviceProps_PlatformType = 13 + DeviceProps_UNKNOWN DeviceProps_PlatformType = 0 + DeviceProps_CHROME DeviceProps_PlatformType = 1 + DeviceProps_FIREFOX DeviceProps_PlatformType = 2 + DeviceProps_IE DeviceProps_PlatformType = 3 + DeviceProps_OPERA DeviceProps_PlatformType = 4 + DeviceProps_SAFARI DeviceProps_PlatformType = 5 + DeviceProps_EDGE DeviceProps_PlatformType = 6 + DeviceProps_DESKTOP DeviceProps_PlatformType = 7 + DeviceProps_IPAD DeviceProps_PlatformType = 8 + DeviceProps_ANDROID_TABLET DeviceProps_PlatformType = 9 + DeviceProps_OHANA DeviceProps_PlatformType = 10 + DeviceProps_ALOHA DeviceProps_PlatformType = 11 + DeviceProps_CATALINA DeviceProps_PlatformType = 12 + DeviceProps_TCL_TV DeviceProps_PlatformType = 13 + DeviceProps_IOS_PHONE DeviceProps_PlatformType = 14 + DeviceProps_IOS_CATALYST DeviceProps_PlatformType = 15 + DeviceProps_ANDROID_PHONE DeviceProps_PlatformType = 16 + DeviceProps_ANDROID_AMBIGUOUS DeviceProps_PlatformType = 17 ) // Enum value maps for DeviceProps_PlatformType. @@ -235,22 +242,30 @@ var ( 11: "ALOHA", 12: "CATALINA", 13: "TCL_TV", + 14: "IOS_PHONE", + 15: "IOS_CATALYST", + 16: "ANDROID_PHONE", + 17: "ANDROID_AMBIGUOUS", } DeviceProps_PlatformType_value = map[string]int32{ - "UNKNOWN": 0, - "CHROME": 1, - "FIREFOX": 2, - "IE": 3, - "OPERA": 4, - "SAFARI": 5, - "EDGE": 6, - "DESKTOP": 7, - "IPAD": 8, - "ANDROID_TABLET": 9, - "OHANA": 10, - "ALOHA": 11, - "CATALINA": 12, - "TCL_TV": 13, + "UNKNOWN": 0, + "CHROME": 1, + "FIREFOX": 2, + "IE": 3, + "OPERA": 4, + "SAFARI": 5, + "EDGE": 6, + "DESKTOP": 7, + "IPAD": 8, + "ANDROID_TABLET": 9, + "OHANA": 10, + "ALOHA": 11, + "CATALINA": 12, + "TCL_TV": 13, + "IOS_PHONE": 14, + "IOS_CATALYST": 15, + "ANDROID_PHONE": 16, + "ANDROID_AMBIGUOUS": 17, } ) @@ -350,7 +365,7 @@ func (x *PaymentInviteMessage_ServiceType) UnmarshalJSON(b []byte) error { // Deprecated: Use PaymentInviteMessage_ServiceType.Descriptor instead. func (PaymentInviteMessage_ServiceType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{8, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{7, 0} } type OrderMessage_OrderSurface int32 @@ -403,7 +418,7 @@ func (x *OrderMessage_OrderSurface) UnmarshalJSON(b []byte) error { // Deprecated: Use OrderMessage_OrderSurface.Descriptor instead. func (OrderMessage_OrderSurface) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{9, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{8, 0} } type OrderMessage_OrderStatus int32 @@ -456,7 +471,7 @@ func (x *OrderMessage_OrderStatus) UnmarshalJSON(b []byte) error { // Deprecated: Use OrderMessage_OrderStatus.Descriptor instead. func (OrderMessage_OrderStatus) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{9, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{8, 1} } type ListResponseMessage_ListType int32 @@ -512,7 +527,7 @@ func (x *ListResponseMessage_ListType) UnmarshalJSON(b []byte) error { // Deprecated: Use ListResponseMessage_ListType.Descriptor instead. func (ListResponseMessage_ListType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{11, 0} } type ListMessage_ListType int32 @@ -571,7 +586,7 @@ func (x *ListMessage_ListType) UnmarshalJSON(b []byte) error { // Deprecated: Use ListMessage_ListType.Descriptor instead. func (ListMessage_ListType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 0} } type InvoiceMessage_AttachmentType int32 @@ -627,7 +642,7 @@ func (x *InvoiceMessage_AttachmentType) UnmarshalJSON(b []byte) error { // Deprecated: Use InvoiceMessage_AttachmentType.Descriptor instead. func (InvoiceMessage_AttachmentType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{15, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{14, 0} } type InteractiveMessage_ShopMessage_Surface int32 @@ -689,7 +704,7 @@ func (x *InteractiveMessage_ShopMessage_Surface) UnmarshalJSON(b []byte) error { // Deprecated: Use InteractiveMessage_ShopMessage_Surface.Descriptor instead. func (InteractiveMessage_ShopMessage_Surface) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 0, 0} } type HistorySyncNotification_HistorySyncType int32 @@ -701,6 +716,7 @@ const ( HistorySyncNotification_RECENT HistorySyncNotification_HistorySyncType = 3 HistorySyncNotification_PUSH_NAME HistorySyncNotification_HistorySyncType = 4 HistorySyncNotification_NON_BLOCKING_DATA HistorySyncNotification_HistorySyncType = 5 + HistorySyncNotification_ON_DEMAND HistorySyncNotification_HistorySyncType = 6 ) // Enum value maps for HistorySyncNotification_HistorySyncType. @@ -712,6 +728,7 @@ var ( 3: "RECENT", 4: "PUSH_NAME", 5: "NON_BLOCKING_DATA", + 6: "ON_DEMAND", } HistorySyncNotification_HistorySyncType_value = map[string]int32{ "INITIAL_BOOTSTRAP": 0, @@ -720,6 +737,7 @@ var ( "RECENT": 3, "PUSH_NAME": 4, "NON_BLOCKING_DATA": 5, + "ON_DEMAND": 6, } ) @@ -757,7 +775,7 @@ func (x *HistorySyncNotification_HistorySyncType) UnmarshalJSON(b []byte) error // Deprecated: Use HistorySyncNotification_HistorySyncType.Descriptor instead. func (HistorySyncNotification_HistorySyncType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{19, 0} } type HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_DayOfWeekType int32 @@ -828,7 +846,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTime // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_DayOfWeekType.Descriptor instead. func (HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_DayOfWeekType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0, 0, 1, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0, 0, 1, 0} } type HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_CalendarType int32 @@ -884,7 +902,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTime // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_CalendarType.Descriptor instead. func (HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_CalendarType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0, 0, 1, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0, 0, 1, 1} } type GroupInviteMessage_GroupType int32 @@ -940,7 +958,7 @@ func (x *GroupInviteMessage_GroupType) UnmarshalJSON(b []byte) error { // Deprecated: Use GroupInviteMessage_GroupType.Descriptor instead. func (GroupInviteMessage_GroupType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{22, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0} } type ExtendedTextMessage_PreviewType int32 @@ -996,7 +1014,7 @@ func (x *ExtendedTextMessage_PreviewType) UnmarshalJSON(b []byte) error { // Deprecated: Use ExtendedTextMessage_PreviewType.Descriptor instead. func (ExtendedTextMessage_PreviewType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{24, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{23, 0} } type ExtendedTextMessage_InviteLinkGroupType int32 @@ -1058,37 +1076,52 @@ func (x *ExtendedTextMessage_InviteLinkGroupType) UnmarshalJSON(b []byte) error // Deprecated: Use ExtendedTextMessage_InviteLinkGroupType.Descriptor instead. func (ExtendedTextMessage_InviteLinkGroupType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{24, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{23, 1} } type ExtendedTextMessage_FontType int32 const ( - ExtendedTextMessage_SANS_SERIF ExtendedTextMessage_FontType = 0 - ExtendedTextMessage_SERIF ExtendedTextMessage_FontType = 1 - ExtendedTextMessage_NORICAN_REGULAR ExtendedTextMessage_FontType = 2 - ExtendedTextMessage_BRYNDAN_WRITE ExtendedTextMessage_FontType = 3 - ExtendedTextMessage_BEBASNEUE_REGULAR ExtendedTextMessage_FontType = 4 - ExtendedTextMessage_OSWALD_HEAVY ExtendedTextMessage_FontType = 5 + ExtendedTextMessage_SANS_SERIF ExtendedTextMessage_FontType = 0 + ExtendedTextMessage_SERIF ExtendedTextMessage_FontType = 1 + ExtendedTextMessage_NORICAN_REGULAR ExtendedTextMessage_FontType = 2 + ExtendedTextMessage_BRYNDAN_WRITE ExtendedTextMessage_FontType = 3 + ExtendedTextMessage_BEBASNEUE_REGULAR ExtendedTextMessage_FontType = 4 + ExtendedTextMessage_OSWALD_HEAVY ExtendedTextMessage_FontType = 5 + ExtendedTextMessage_DAMION_REGULAR ExtendedTextMessage_FontType = 6 + ExtendedTextMessage_MORNINGBREEZE_REGULAR ExtendedTextMessage_FontType = 7 + ExtendedTextMessage_CALISTOGA_REGULAR ExtendedTextMessage_FontType = 8 + ExtendedTextMessage_EXO2_EXTRABOLD ExtendedTextMessage_FontType = 9 + ExtendedTextMessage_COURIERPRIME_BOLD ExtendedTextMessage_FontType = 10 ) // Enum value maps for ExtendedTextMessage_FontType. var ( ExtendedTextMessage_FontType_name = map[int32]string{ - 0: "SANS_SERIF", - 1: "SERIF", - 2: "NORICAN_REGULAR", - 3: "BRYNDAN_WRITE", - 4: "BEBASNEUE_REGULAR", - 5: "OSWALD_HEAVY", + 0: "SANS_SERIF", + 1: "SERIF", + 2: "NORICAN_REGULAR", + 3: "BRYNDAN_WRITE", + 4: "BEBASNEUE_REGULAR", + 5: "OSWALD_HEAVY", + 6: "DAMION_REGULAR", + 7: "MORNINGBREEZE_REGULAR", + 8: "CALISTOGA_REGULAR", + 9: "EXO2_EXTRABOLD", + 10: "COURIERPRIME_BOLD", } ExtendedTextMessage_FontType_value = map[string]int32{ - "SANS_SERIF": 0, - "SERIF": 1, - "NORICAN_REGULAR": 2, - "BRYNDAN_WRITE": 3, - "BEBASNEUE_REGULAR": 4, - "OSWALD_HEAVY": 5, + "SANS_SERIF": 0, + "SERIF": 1, + "NORICAN_REGULAR": 2, + "BRYNDAN_WRITE": 3, + "BEBASNEUE_REGULAR": 4, + "OSWALD_HEAVY": 5, + "DAMION_REGULAR": 6, + "MORNINGBREEZE_REGULAR": 7, + "CALISTOGA_REGULAR": 8, + "EXO2_EXTRABOLD": 9, + "COURIERPRIME_BOLD": 10, } ) @@ -1126,7 +1159,7 @@ func (x *ExtendedTextMessage_FontType) UnmarshalJSON(b []byte) error { // Deprecated: Use ExtendedTextMessage_FontType.Descriptor instead. func (ExtendedTextMessage_FontType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{24, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{23, 2} } type ButtonsResponseMessage_Type int32 @@ -1182,7 +1215,7 @@ func (x *ButtonsResponseMessage_Type) UnmarshalJSON(b []byte) error { // Deprecated: Use ButtonsResponseMessage_Type.Descriptor instead. func (ButtonsResponseMessage_Type) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{34, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{33, 0} } type ButtonsMessage_HeaderType int32 @@ -1253,7 +1286,7 @@ func (x *ButtonsMessage_HeaderType) UnmarshalJSON(b []byte) error { // Deprecated: Use ButtonsMessage_HeaderType.Descriptor instead. func (ButtonsMessage_HeaderType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{35, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{34, 0} } type ButtonsMessage_Button_Type int32 @@ -1312,7 +1345,7 @@ func (x *ButtonsMessage_Button_Type) UnmarshalJSON(b []byte) error { // Deprecated: Use ButtonsMessage_Button_Type.Descriptor instead. func (ButtonsMessage_Button_Type) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{35, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{34, 0, 0} } type DisappearingMode_Initiator int32 @@ -1430,7 +1463,7 @@ func (x *ContextInfo_ExternalAdReplyInfo_MediaType) UnmarshalJSON(b []byte) erro // Deprecated: Use ContextInfo_ExternalAdReplyInfo_MediaType.Descriptor instead. func (ContextInfo_ExternalAdReplyInfo_MediaType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 1, 0} } type ContextInfo_AdReplyInfo_MediaType int32 @@ -1489,7 +1522,7 @@ func (x *ContextInfo_AdReplyInfo_MediaType) UnmarshalJSON(b []byte) error { // Deprecated: Use ContextInfo_AdReplyInfo_MediaType.Descriptor instead. func (ContextInfo_AdReplyInfo_MediaType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 1, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 2, 0} } type PaymentBackground_Type int32 @@ -1607,6 +1640,121 @@ func (VideoMessage_Attribution) EnumDescriptor() ([]byte, []int) { return file_binary_proto_def_proto_rawDescGZIP(), []int{57, 0} } +type ScheduledCallEditMessage_EditType int32 + +const ( + ScheduledCallEditMessage_UNKNOWN ScheduledCallEditMessage_EditType = 0 + ScheduledCallEditMessage_CANCEL ScheduledCallEditMessage_EditType = 1 +) + +// Enum value maps for ScheduledCallEditMessage_EditType. +var ( + ScheduledCallEditMessage_EditType_name = map[int32]string{ + 0: "UNKNOWN", + 1: "CANCEL", + } + ScheduledCallEditMessage_EditType_value = map[string]int32{ + "UNKNOWN": 0, + "CANCEL": 1, + } +) + +func (x ScheduledCallEditMessage_EditType) Enum() *ScheduledCallEditMessage_EditType { + p := new(ScheduledCallEditMessage_EditType) + *p = x + return p +} + +func (x ScheduledCallEditMessage_EditType) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (ScheduledCallEditMessage_EditType) Descriptor() protoreflect.EnumDescriptor { + return file_binary_proto_def_proto_enumTypes[26].Descriptor() +} + +func (ScheduledCallEditMessage_EditType) Type() protoreflect.EnumType { + return &file_binary_proto_def_proto_enumTypes[26] +} + +func (x ScheduledCallEditMessage_EditType) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *ScheduledCallEditMessage_EditType) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = ScheduledCallEditMessage_EditType(num) + return nil +} + +// Deprecated: Use ScheduledCallEditMessage_EditType.Descriptor instead. +func (ScheduledCallEditMessage_EditType) EnumDescriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{64, 0} +} + +type ScheduledCallCreationMessage_CallType int32 + +const ( + ScheduledCallCreationMessage_UNKNOWN ScheduledCallCreationMessage_CallType = 0 + ScheduledCallCreationMessage_VOICE ScheduledCallCreationMessage_CallType = 1 + ScheduledCallCreationMessage_VIDEO ScheduledCallCreationMessage_CallType = 2 +) + +// Enum value maps for ScheduledCallCreationMessage_CallType. +var ( + ScheduledCallCreationMessage_CallType_name = map[int32]string{ + 0: "UNKNOWN", + 1: "VOICE", + 2: "VIDEO", + } + ScheduledCallCreationMessage_CallType_value = map[string]int32{ + "UNKNOWN": 0, + "VOICE": 1, + "VIDEO": 2, + } +) + +func (x ScheduledCallCreationMessage_CallType) Enum() *ScheduledCallCreationMessage_CallType { + p := new(ScheduledCallCreationMessage_CallType) + *p = x + return p +} + +func (x ScheduledCallCreationMessage_CallType) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (ScheduledCallCreationMessage_CallType) Descriptor() protoreflect.EnumDescriptor { + return file_binary_proto_def_proto_enumTypes[27].Descriptor() +} + +func (ScheduledCallCreationMessage_CallType) Type() protoreflect.EnumType { + return &file_binary_proto_def_proto_enumTypes[27] +} + +func (x ScheduledCallCreationMessage_CallType) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *ScheduledCallCreationMessage_CallType) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = ScheduledCallCreationMessage_CallType(num) + return nil +} + +// Deprecated: Use ScheduledCallCreationMessage_CallType.Descriptor instead. +func (ScheduledCallCreationMessage_CallType) EnumDescriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{65, 0} +} + type ProtocolMessage_Type int32 const ( @@ -1670,11 +1818,11 @@ func (x ProtocolMessage_Type) String() string { } func (ProtocolMessage_Type) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[26].Descriptor() + return file_binary_proto_def_proto_enumTypes[28].Descriptor() } func (ProtocolMessage_Type) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[26] + return &file_binary_proto_def_proto_enumTypes[28] } func (x ProtocolMessage_Type) Number() protoreflect.EnumNumber { @@ -1693,7 +1841,66 @@ func (x *ProtocolMessage_Type) UnmarshalJSON(b []byte) error { // Deprecated: Use ProtocolMessage_Type.Descriptor instead. func (ProtocolMessage_Type) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{67, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{69, 0} +} + +type PinMessage_PinMessageType int32 + +const ( + PinMessage_UNKNOWN_PIN_MESSAGE_TYPE PinMessage_PinMessageType = 0 + PinMessage_PIN_FOR_ALL PinMessage_PinMessageType = 1 + PinMessage_UNPIN_FOR_ALL PinMessage_PinMessageType = 2 +) + +// Enum value maps for PinMessage_PinMessageType. +var ( + PinMessage_PinMessageType_name = map[int32]string{ + 0: "UNKNOWN_PIN_MESSAGE_TYPE", + 1: "PIN_FOR_ALL", + 2: "UNPIN_FOR_ALL", + } + PinMessage_PinMessageType_value = map[string]int32{ + "UNKNOWN_PIN_MESSAGE_TYPE": 0, + "PIN_FOR_ALL": 1, + "UNPIN_FOR_ALL": 2, + } +) + +func (x PinMessage_PinMessageType) Enum() *PinMessage_PinMessageType { + p := new(PinMessage_PinMessageType) + *p = x + return p +} + +func (x PinMessage_PinMessageType) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (PinMessage_PinMessageType) Descriptor() protoreflect.EnumDescriptor { + return file_binary_proto_def_proto_enumTypes[29].Descriptor() +} + +func (PinMessage_PinMessageType) Type() protoreflect.EnumType { + return &file_binary_proto_def_proto_enumTypes[29] +} + +func (x PinMessage_PinMessageType) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *PinMessage_PinMessageType) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = PinMessage_PinMessageType(num) + return nil +} + +// Deprecated: Use PinMessage_PinMessageType.Descriptor instead. +func (PinMessage_PinMessageType) EnumDescriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{76, 0} } type PastParticipant_LeaveReason int32 @@ -1726,11 +1933,11 @@ func (x PastParticipant_LeaveReason) String() string { } func (PastParticipant_LeaveReason) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[27].Descriptor() + return file_binary_proto_def_proto_enumTypes[30].Descriptor() } func (PastParticipant_LeaveReason) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[27] + return &file_binary_proto_def_proto_enumTypes[30] } func (x PastParticipant_LeaveReason) Number() protoreflect.EnumNumber { @@ -1749,7 +1956,7 @@ func (x *PastParticipant_LeaveReason) UnmarshalJSON(b []byte) error { // Deprecated: Use PastParticipant_LeaveReason.Descriptor instead. func (PastParticipant_LeaveReason) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{79, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{83, 0} } type HistorySync_HistorySyncType int32 @@ -1761,6 +1968,7 @@ const ( HistorySync_RECENT HistorySync_HistorySyncType = 3 HistorySync_PUSH_NAME HistorySync_HistorySyncType = 4 HistorySync_NON_BLOCKING_DATA HistorySync_HistorySyncType = 5 + HistorySync_ON_DEMAND HistorySync_HistorySyncType = 6 ) // Enum value maps for HistorySync_HistorySyncType. @@ -1772,6 +1980,7 @@ var ( 3: "RECENT", 4: "PUSH_NAME", 5: "NON_BLOCKING_DATA", + 6: "ON_DEMAND", } HistorySync_HistorySyncType_value = map[string]int32{ "INITIAL_BOOTSTRAP": 0, @@ -1780,6 +1989,7 @@ var ( "RECENT": 3, "PUSH_NAME": 4, "NON_BLOCKING_DATA": 5, + "ON_DEMAND": 6, } ) @@ -1794,11 +2004,11 @@ func (x HistorySync_HistorySyncType) String() string { } func (HistorySync_HistorySyncType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[28].Descriptor() + return file_binary_proto_def_proto_enumTypes[31].Descriptor() } func (HistorySync_HistorySyncType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[28] + return &file_binary_proto_def_proto_enumTypes[31] } func (x HistorySync_HistorySyncType) Number() protoreflect.EnumNumber { @@ -1817,7 +2027,7 @@ func (x *HistorySync_HistorySyncType) UnmarshalJSON(b []byte) error { // Deprecated: Use HistorySync_HistorySyncType.Descriptor instead. func (HistorySync_HistorySyncType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{80, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{84, 0} } type GroupParticipant_Rank int32 @@ -1853,11 +2063,11 @@ func (x GroupParticipant_Rank) String() string { } func (GroupParticipant_Rank) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[29].Descriptor() + return file_binary_proto_def_proto_enumTypes[32].Descriptor() } func (GroupParticipant_Rank) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[29] + return &file_binary_proto_def_proto_enumTypes[32] } func (x GroupParticipant_Rank) Number() protoreflect.EnumNumber { @@ -1876,7 +2086,7 @@ func (x *GroupParticipant_Rank) UnmarshalJSON(b []byte) error { // Deprecated: Use GroupParticipant_Rank.Descriptor instead. func (GroupParticipant_Rank) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{82, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{86, 0} } type Conversation_EndOfHistoryTransferType int32 @@ -1909,11 +2119,11 @@ func (x Conversation_EndOfHistoryTransferType) String() string { } func (Conversation_EndOfHistoryTransferType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[30].Descriptor() + return file_binary_proto_def_proto_enumTypes[33].Descriptor() } func (Conversation_EndOfHistoryTransferType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[30] + return &file_binary_proto_def_proto_enumTypes[33] } func (x Conversation_EndOfHistoryTransferType) Number() protoreflect.EnumNumber { @@ -1932,7 +2142,7 @@ func (x *Conversation_EndOfHistoryTransferType) UnmarshalJSON(b []byte) error { // Deprecated: Use Conversation_EndOfHistoryTransferType.Descriptor instead. func (Conversation_EndOfHistoryTransferType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{84, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{88, 0} } type MediaRetryNotification_ResultType int32 @@ -1971,11 +2181,11 @@ func (x MediaRetryNotification_ResultType) String() string { } func (MediaRetryNotification_ResultType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[31].Descriptor() + return file_binary_proto_def_proto_enumTypes[34].Descriptor() } func (MediaRetryNotification_ResultType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[31] + return &file_binary_proto_def_proto_enumTypes[34] } func (x MediaRetryNotification_ResultType) Number() protoreflect.EnumNumber { @@ -1994,7 +2204,7 @@ func (x *MediaRetryNotification_ResultType) UnmarshalJSON(b []byte) error { // Deprecated: Use MediaRetryNotification_ResultType.Descriptor instead. func (MediaRetryNotification_ResultType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{90, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{94, 0} } type SyncdMutation_SyncdOperation int32 @@ -2027,11 +2237,11 @@ func (x SyncdMutation_SyncdOperation) String() string { } func (SyncdMutation_SyncdOperation) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[32].Descriptor() + return file_binary_proto_def_proto_enumTypes[35].Descriptor() } func (SyncdMutation_SyncdOperation) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[32] + return &file_binary_proto_def_proto_enumTypes[35] } func (x SyncdMutation_SyncdOperation) Number() protoreflect.EnumNumber { @@ -2050,7 +2260,7 @@ func (x *SyncdMutation_SyncdOperation) UnmarshalJSON(b []byte) error { // Deprecated: Use SyncdMutation_SyncdOperation.Descriptor instead. func (SyncdMutation_SyncdOperation) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{98, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{102, 0} } type BizIdentityInfo_VerifiedLevelValue int32 @@ -2086,11 +2296,11 @@ func (x BizIdentityInfo_VerifiedLevelValue) String() string { } func (BizIdentityInfo_VerifiedLevelValue) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[33].Descriptor() + return file_binary_proto_def_proto_enumTypes[36].Descriptor() } func (BizIdentityInfo_VerifiedLevelValue) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[33] + return &file_binary_proto_def_proto_enumTypes[36] } func (x BizIdentityInfo_VerifiedLevelValue) Number() protoreflect.EnumNumber { @@ -2109,7 +2319,7 @@ func (x *BizIdentityInfo_VerifiedLevelValue) UnmarshalJSON(b []byte) error { // Deprecated: Use BizIdentityInfo_VerifiedLevelValue.Descriptor instead. func (BizIdentityInfo_VerifiedLevelValue) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{141, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{145, 0} } type BizIdentityInfo_HostStorageType int32 @@ -2142,11 +2352,11 @@ func (x BizIdentityInfo_HostStorageType) String() string { } func (BizIdentityInfo_HostStorageType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[34].Descriptor() + return file_binary_proto_def_proto_enumTypes[37].Descriptor() } func (BizIdentityInfo_HostStorageType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[34] + return &file_binary_proto_def_proto_enumTypes[37] } func (x BizIdentityInfo_HostStorageType) Number() protoreflect.EnumNumber { @@ -2165,7 +2375,7 @@ func (x *BizIdentityInfo_HostStorageType) UnmarshalJSON(b []byte) error { // Deprecated: Use BizIdentityInfo_HostStorageType.Descriptor instead. func (BizIdentityInfo_HostStorageType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{141, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{145, 1} } type BizIdentityInfo_ActualActorsType int32 @@ -2198,11 +2408,11 @@ func (x BizIdentityInfo_ActualActorsType) String() string { } func (BizIdentityInfo_ActualActorsType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[35].Descriptor() + return file_binary_proto_def_proto_enumTypes[38].Descriptor() } func (BizIdentityInfo_ActualActorsType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[35] + return &file_binary_proto_def_proto_enumTypes[38] } func (x BizIdentityInfo_ActualActorsType) Number() protoreflect.EnumNumber { @@ -2221,7 +2431,7 @@ func (x *BizIdentityInfo_ActualActorsType) UnmarshalJSON(b []byte) error { // Deprecated: Use BizIdentityInfo_ActualActorsType.Descriptor instead. func (BizIdentityInfo_ActualActorsType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{141, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{145, 2} } type BizAccountLinkInfo_HostStorageType int32 @@ -2254,11 +2464,11 @@ func (x BizAccountLinkInfo_HostStorageType) String() string { } func (BizAccountLinkInfo_HostStorageType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[36].Descriptor() + return file_binary_proto_def_proto_enumTypes[39].Descriptor() } func (BizAccountLinkInfo_HostStorageType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[36] + return &file_binary_proto_def_proto_enumTypes[39] } func (x BizAccountLinkInfo_HostStorageType) Number() protoreflect.EnumNumber { @@ -2277,7 +2487,7 @@ func (x *BizAccountLinkInfo_HostStorageType) UnmarshalJSON(b []byte) error { // Deprecated: Use BizAccountLinkInfo_HostStorageType.Descriptor instead. func (BizAccountLinkInfo_HostStorageType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{143, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{147, 0} } type BizAccountLinkInfo_AccountType int32 @@ -2307,11 +2517,11 @@ func (x BizAccountLinkInfo_AccountType) String() string { } func (BizAccountLinkInfo_AccountType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[37].Descriptor() + return file_binary_proto_def_proto_enumTypes[40].Descriptor() } func (BizAccountLinkInfo_AccountType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[37] + return &file_binary_proto_def_proto_enumTypes[40] } func (x BizAccountLinkInfo_AccountType) Number() protoreflect.EnumNumber { @@ -2330,7 +2540,7 @@ func (x *BizAccountLinkInfo_AccountType) UnmarshalJSON(b []byte) error { // Deprecated: Use BizAccountLinkInfo_AccountType.Descriptor instead. func (BizAccountLinkInfo_AccountType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{143, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{147, 1} } type ClientPayload_Product int32 @@ -2363,11 +2573,11 @@ func (x ClientPayload_Product) String() string { } func (ClientPayload_Product) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[38].Descriptor() + return file_binary_proto_def_proto_enumTypes[41].Descriptor() } func (ClientPayload_Product) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[38] + return &file_binary_proto_def_proto_enumTypes[41] } func (x ClientPayload_Product) Number() protoreflect.EnumNumber { @@ -2386,7 +2596,7 @@ func (x *ClientPayload_Product) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_Product.Descriptor instead. func (ClientPayload_Product) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 0} } type ClientPayload_IOSAppExtension int32 @@ -2422,11 +2632,11 @@ func (x ClientPayload_IOSAppExtension) String() string { } func (ClientPayload_IOSAppExtension) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[39].Descriptor() + return file_binary_proto_def_proto_enumTypes[42].Descriptor() } func (ClientPayload_IOSAppExtension) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[39] + return &file_binary_proto_def_proto_enumTypes[42] } func (x ClientPayload_IOSAppExtension) Number() protoreflect.EnumNumber { @@ -2445,7 +2655,7 @@ func (x *ClientPayload_IOSAppExtension) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_IOSAppExtension.Descriptor instead. func (ClientPayload_IOSAppExtension) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 1} } type ClientPayload_ConnectType int32 @@ -2517,11 +2727,11 @@ func (x ClientPayload_ConnectType) String() string { } func (ClientPayload_ConnectType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[40].Descriptor() + return file_binary_proto_def_proto_enumTypes[43].Descriptor() } func (ClientPayload_ConnectType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[40] + return &file_binary_proto_def_proto_enumTypes[43] } func (x ClientPayload_ConnectType) Number() protoreflect.EnumNumber { @@ -2540,7 +2750,7 @@ func (x *ClientPayload_ConnectType) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_ConnectType.Descriptor instead. func (ClientPayload_ConnectType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 2} } type ClientPayload_ConnectReason int32 @@ -2585,11 +2795,11 @@ func (x ClientPayload_ConnectReason) String() string { } func (ClientPayload_ConnectReason) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[41].Descriptor() + return file_binary_proto_def_proto_enumTypes[44].Descriptor() } func (ClientPayload_ConnectReason) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[41] + return &file_binary_proto_def_proto_enumTypes[44] } func (x ClientPayload_ConnectReason) Number() protoreflect.EnumNumber { @@ -2608,66 +2818,7 @@ func (x *ClientPayload_ConnectReason) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_ConnectReason.Descriptor instead. func (ClientPayload_ConnectReason) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 3} -} - -type ClientPayload_BizMarketSegment int32 - -const ( - ClientPayload_DEFAULT ClientPayload_BizMarketSegment = 0 - ClientPayload_DEVX ClientPayload_BizMarketSegment = 1 - ClientPayload_INBOX ClientPayload_BizMarketSegment = 2 -) - -// Enum value maps for ClientPayload_BizMarketSegment. -var ( - ClientPayload_BizMarketSegment_name = map[int32]string{ - 0: "DEFAULT", - 1: "DEVX", - 2: "INBOX", - } - ClientPayload_BizMarketSegment_value = map[string]int32{ - "DEFAULT": 0, - "DEVX": 1, - "INBOX": 2, - } -) - -func (x ClientPayload_BizMarketSegment) Enum() *ClientPayload_BizMarketSegment { - p := new(ClientPayload_BizMarketSegment) - *p = x - return p -} - -func (x ClientPayload_BizMarketSegment) String() string { - return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) -} - -func (ClientPayload_BizMarketSegment) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[42].Descriptor() -} - -func (ClientPayload_BizMarketSegment) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[42] -} - -func (x ClientPayload_BizMarketSegment) Number() protoreflect.EnumNumber { - return protoreflect.EnumNumber(x) -} - -// Deprecated: Do not use. -func (x *ClientPayload_BizMarketSegment) UnmarshalJSON(b []byte) error { - num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) - if err != nil { - return err - } - *x = ClientPayload_BizMarketSegment(num) - return nil -} - -// Deprecated: Use ClientPayload_BizMarketSegment.Descriptor instead. -func (ClientPayload_BizMarketSegment) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 4} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 3} } type ClientPayload_WebInfo_WebSubPlatform int32 @@ -2709,11 +2860,11 @@ func (x ClientPayload_WebInfo_WebSubPlatform) String() string { } func (ClientPayload_WebInfo_WebSubPlatform) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[43].Descriptor() + return file_binary_proto_def_proto_enumTypes[45].Descriptor() } func (ClientPayload_WebInfo_WebSubPlatform) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[43] + return &file_binary_proto_def_proto_enumTypes[45] } func (x ClientPayload_WebInfo_WebSubPlatform) Number() protoreflect.EnumNumber { @@ -2732,7 +2883,7 @@ func (x *ClientPayload_WebInfo_WebSubPlatform) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_WebInfo_WebSubPlatform.Descriptor instead. func (ClientPayload_WebInfo_WebSubPlatform) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 0, 0} } type ClientPayload_UserAgent_ReleaseChannel int32 @@ -2771,11 +2922,11 @@ func (x ClientPayload_UserAgent_ReleaseChannel) String() string { } func (ClientPayload_UserAgent_ReleaseChannel) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[44].Descriptor() + return file_binary_proto_def_proto_enumTypes[46].Descriptor() } func (ClientPayload_UserAgent_ReleaseChannel) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[44] + return &file_binary_proto_def_proto_enumTypes[46] } func (x ClientPayload_UserAgent_ReleaseChannel) Number() protoreflect.EnumNumber { @@ -2794,7 +2945,7 @@ func (x *ClientPayload_UserAgent_ReleaseChannel) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_UserAgent_ReleaseChannel.Descriptor instead. func (ClientPayload_UserAgent_ReleaseChannel) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 1, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 1, 0} } type ClientPayload_UserAgent_Platform int32 @@ -2832,6 +2983,7 @@ const ( ClientPayload_UserAgent_WEAROS ClientPayload_UserAgent_Platform = 29 ClientPayload_UserAgent_ARDEVICE ClientPayload_UserAgent_Platform = 30 ClientPayload_UserAgent_VRDEVICE ClientPayload_UserAgent_Platform = 31 + ClientPayload_UserAgent_BLUE_WEB ClientPayload_UserAgent_Platform = 32 ) // Enum value maps for ClientPayload_UserAgent_Platform. @@ -2869,6 +3021,7 @@ var ( 29: "WEAROS", 30: "ARDEVICE", 31: "VRDEVICE", + 32: "BLUE_WEB", } ClientPayload_UserAgent_Platform_value = map[string]int32{ "ANDROID": 0, @@ -2903,6 +3056,7 @@ var ( "WEAROS": 29, "ARDEVICE": 30, "VRDEVICE": 31, + "BLUE_WEB": 32, } ) @@ -2917,11 +3071,11 @@ func (x ClientPayload_UserAgent_Platform) String() string { } func (ClientPayload_UserAgent_Platform) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[45].Descriptor() + return file_binary_proto_def_proto_enumTypes[47].Descriptor() } func (ClientPayload_UserAgent_Platform) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[45] + return &file_binary_proto_def_proto_enumTypes[47] } func (x ClientPayload_UserAgent_Platform) Number() protoreflect.EnumNumber { @@ -2940,7 +3094,7 @@ func (x *ClientPayload_UserAgent_Platform) UnmarshalJSON(b []byte) error { // Deprecated: Use ClientPayload_UserAgent_Platform.Descriptor instead. func (ClientPayload_UserAgent_Platform) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 1, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 1, 1} } type ClientPayload_DNSSource_DNSResolutionMethod int32 @@ -2982,11 +3136,11 @@ func (x ClientPayload_DNSSource_DNSResolutionMethod) String() string { } func (ClientPayload_DNSSource_DNSResolutionMethod) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[46].Descriptor() + return file_binary_proto_def_proto_enumTypes[48].Descriptor() } func (ClientPayload_DNSSource_DNSResolutionMethod) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[46] + return &file_binary_proto_def_proto_enumTypes[48] } func (x ClientPayload_DNSSource_DNSResolutionMethod) Number() protoreflect.EnumNumber { @@ -3005,7 +3159,7 @@ func (x *ClientPayload_DNSSource_DNSResolutionMethod) UnmarshalJSON(b []byte) er // Deprecated: Use ClientPayload_DNSSource_DNSResolutionMethod.Descriptor instead. func (ClientPayload_DNSSource_DNSResolutionMethod) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 3, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 3, 0} } type WebMessageInfo_StubType int32 @@ -3518,11 +3672,11 @@ func (x WebMessageInfo_StubType) String() string { } func (WebMessageInfo_StubType) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[47].Descriptor() + return file_binary_proto_def_proto_enumTypes[49].Descriptor() } func (WebMessageInfo_StubType) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[47] + return &file_binary_proto_def_proto_enumTypes[49] } func (x WebMessageInfo_StubType) Number() protoreflect.EnumNumber { @@ -3541,7 +3695,7 @@ func (x *WebMessageInfo_StubType) UnmarshalJSON(b []byte) error { // Deprecated: Use WebMessageInfo_StubType.Descriptor instead. func (WebMessageInfo_StubType) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{150, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{154, 0} } type WebMessageInfo_Status int32 @@ -3586,11 +3740,11 @@ func (x WebMessageInfo_Status) String() string { } func (WebMessageInfo_Status) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[48].Descriptor() + return file_binary_proto_def_proto_enumTypes[50].Descriptor() } func (WebMessageInfo_Status) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[48] + return &file_binary_proto_def_proto_enumTypes[50] } func (x WebMessageInfo_Status) Number() protoreflect.EnumNumber { @@ -3609,7 +3763,7 @@ func (x *WebMessageInfo_Status) UnmarshalJSON(b []byte) error { // Deprecated: Use WebMessageInfo_Status.Descriptor instead. func (WebMessageInfo_Status) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{150, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{154, 1} } type WebMessageInfo_BizPrivacyStatus int32 @@ -3648,11 +3802,11 @@ func (x WebMessageInfo_BizPrivacyStatus) String() string { } func (WebMessageInfo_BizPrivacyStatus) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[49].Descriptor() + return file_binary_proto_def_proto_enumTypes[51].Descriptor() } func (WebMessageInfo_BizPrivacyStatus) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[49] + return &file_binary_proto_def_proto_enumTypes[51] } func (x WebMessageInfo_BizPrivacyStatus) Number() protoreflect.EnumNumber { @@ -3671,7 +3825,7 @@ func (x *WebMessageInfo_BizPrivacyStatus) UnmarshalJSON(b []byte) error { // Deprecated: Use WebMessageInfo_BizPrivacyStatus.Descriptor instead. func (WebMessageInfo_BizPrivacyStatus) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{150, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{154, 2} } type WebFeatures_Flag int32 @@ -3710,11 +3864,11 @@ func (x WebFeatures_Flag) String() string { } func (WebFeatures_Flag) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[50].Descriptor() + return file_binary_proto_def_proto_enumTypes[52].Descriptor() } func (WebFeatures_Flag) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[50] + return &file_binary_proto_def_proto_enumTypes[52] } func (x WebFeatures_Flag) Number() protoreflect.EnumNumber { @@ -3733,7 +3887,7 @@ func (x *WebFeatures_Flag) UnmarshalJSON(b []byte) error { // Deprecated: Use WebFeatures_Flag.Descriptor instead. func (WebFeatures_Flag) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{151, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{155, 0} } type PaymentInfo_TxnStatus int32 @@ -3856,11 +4010,11 @@ func (x PaymentInfo_TxnStatus) String() string { } func (PaymentInfo_TxnStatus) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[51].Descriptor() + return file_binary_proto_def_proto_enumTypes[53].Descriptor() } func (PaymentInfo_TxnStatus) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[51] + return &file_binary_proto_def_proto_enumTypes[53] } func (x PaymentInfo_TxnStatus) Number() protoreflect.EnumNumber { @@ -3879,7 +4033,7 @@ func (x *PaymentInfo_TxnStatus) UnmarshalJSON(b []byte) error { // Deprecated: Use PaymentInfo_TxnStatus.Descriptor instead. func (PaymentInfo_TxnStatus) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{158, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{162, 0} } type PaymentInfo_Status int32 @@ -3942,11 +4096,11 @@ func (x PaymentInfo_Status) String() string { } func (PaymentInfo_Status) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[52].Descriptor() + return file_binary_proto_def_proto_enumTypes[54].Descriptor() } func (PaymentInfo_Status) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[52] + return &file_binary_proto_def_proto_enumTypes[54] } func (x PaymentInfo_Status) Number() protoreflect.EnumNumber { @@ -3965,7 +4119,7 @@ func (x *PaymentInfo_Status) UnmarshalJSON(b []byte) error { // Deprecated: Use PaymentInfo_Status.Descriptor instead. func (PaymentInfo_Status) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{158, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{162, 1} } type PaymentInfo_Currency int32 @@ -3998,11 +4152,11 @@ func (x PaymentInfo_Currency) String() string { } func (PaymentInfo_Currency) Descriptor() protoreflect.EnumDescriptor { - return file_binary_proto_def_proto_enumTypes[53].Descriptor() + return file_binary_proto_def_proto_enumTypes[55].Descriptor() } func (PaymentInfo_Currency) Type() protoreflect.EnumType { - return &file_binary_proto_def_proto_enumTypes[53] + return &file_binary_proto_def_proto_enumTypes[55] } func (x PaymentInfo_Currency) Number() protoreflect.EnumNumber { @@ -4021,7 +4175,7 @@ func (x *PaymentInfo_Currency) UnmarshalJSON(b []byte) error { // Deprecated: Use PaymentInfo_Currency.Descriptor instead. func (PaymentInfo_Currency) EnumDescriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{158, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{162, 2} } type ADVSignedKeyIndexList struct { @@ -4418,83 +4572,21 @@ func (x *DeviceProps) GetHistorySyncConfig() *DeviceProps_HistorySyncConfig { return nil } -type PeerDataOperationRequestResponseMessage struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - PeerDataOperationRequestType *PeerDataOperationRequestType `protobuf:"varint,1,opt,name=peerDataOperationRequestType,enum=proto.PeerDataOperationRequestType" json:"peerDataOperationRequestType,omitempty"` - StanzaId *string `protobuf:"bytes,2,opt,name=stanzaId" json:"stanzaId,omitempty"` - PeerDataOperationResult []*PeerDataOperationRequestResponseMessage_PeerDataOperationResult `protobuf:"bytes,3,rep,name=peerDataOperationResult" json:"peerDataOperationResult,omitempty"` -} - -func (x *PeerDataOperationRequestResponseMessage) Reset() { - *x = PeerDataOperationRequestResponseMessage{} - if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[6] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *PeerDataOperationRequestResponseMessage) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*PeerDataOperationRequestResponseMessage) ProtoMessage() {} - -func (x *PeerDataOperationRequestResponseMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[6] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use PeerDataOperationRequestResponseMessage.ProtoReflect.Descriptor instead. -func (*PeerDataOperationRequestResponseMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{6} -} - -func (x *PeerDataOperationRequestResponseMessage) GetPeerDataOperationRequestType() PeerDataOperationRequestType { - if x != nil && x.PeerDataOperationRequestType != nil { - return *x.PeerDataOperationRequestType - } - return PeerDataOperationRequestType_UPLOAD_STICKER -} - -func (x *PeerDataOperationRequestResponseMessage) GetStanzaId() string { - if x != nil && x.StanzaId != nil { - return *x.StanzaId - } - return "" -} - -func (x *PeerDataOperationRequestResponseMessage) GetPeerDataOperationResult() []*PeerDataOperationRequestResponseMessage_PeerDataOperationResult { - if x != nil { - return x.PeerDataOperationResult - } - return nil -} - type PeerDataOperationRequestMessage struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache unknownFields protoimpl.UnknownFields - PeerDataOperationRequestType *PeerDataOperationRequestType `protobuf:"varint,1,opt,name=peerDataOperationRequestType,enum=proto.PeerDataOperationRequestType" json:"peerDataOperationRequestType,omitempty"` - RequestStickerReupload []*PeerDataOperationRequestMessage_RequestStickerReupload `protobuf:"bytes,2,rep,name=requestStickerReupload" json:"requestStickerReupload,omitempty"` - RequestUrlPreview []*PeerDataOperationRequestMessage_RequestUrlPreview `protobuf:"bytes,3,rep,name=requestUrlPreview" json:"requestUrlPreview,omitempty"` + PeerDataOperationRequestType *PeerDataOperationRequestType `protobuf:"varint,1,opt,name=peerDataOperationRequestType,enum=proto.PeerDataOperationRequestType" json:"peerDataOperationRequestType,omitempty"` + RequestStickerReupload []*PeerDataOperationRequestMessage_RequestStickerReupload `protobuf:"bytes,2,rep,name=requestStickerReupload" json:"requestStickerReupload,omitempty"` + RequestUrlPreview []*PeerDataOperationRequestMessage_RequestUrlPreview `protobuf:"bytes,3,rep,name=requestUrlPreview" json:"requestUrlPreview,omitempty"` + HistorySyncOnDemandRequest *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest `protobuf:"bytes,4,opt,name=historySyncOnDemandRequest" json:"historySyncOnDemandRequest,omitempty"` } func (x *PeerDataOperationRequestMessage) Reset() { *x = PeerDataOperationRequestMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[7] + mi := &file_binary_proto_def_proto_msgTypes[6] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4507,7 +4599,7 @@ func (x *PeerDataOperationRequestMessage) String() string { func (*PeerDataOperationRequestMessage) ProtoMessage() {} func (x *PeerDataOperationRequestMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[7] + mi := &file_binary_proto_def_proto_msgTypes[6] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4520,7 +4612,7 @@ func (x *PeerDataOperationRequestMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use PeerDataOperationRequestMessage.ProtoReflect.Descriptor instead. func (*PeerDataOperationRequestMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{7} + return file_binary_proto_def_proto_rawDescGZIP(), []int{6} } func (x *PeerDataOperationRequestMessage) GetPeerDataOperationRequestType() PeerDataOperationRequestType { @@ -4544,6 +4636,13 @@ func (x *PeerDataOperationRequestMessage) GetRequestUrlPreview() []*PeerDataOper return nil } +func (x *PeerDataOperationRequestMessage) GetHistorySyncOnDemandRequest() *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest { + if x != nil { + return x.HistorySyncOnDemandRequest + } + return nil +} + type PaymentInviteMessage struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -4556,7 +4655,7 @@ type PaymentInviteMessage struct { func (x *PaymentInviteMessage) Reset() { *x = PaymentInviteMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[8] + mi := &file_binary_proto_def_proto_msgTypes[7] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4569,7 +4668,7 @@ func (x *PaymentInviteMessage) String() string { func (*PaymentInviteMessage) ProtoMessage() {} func (x *PaymentInviteMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[8] + mi := &file_binary_proto_def_proto_msgTypes[7] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4582,7 +4681,7 @@ func (x *PaymentInviteMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use PaymentInviteMessage.ProtoReflect.Descriptor instead. func (*PaymentInviteMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{8} + return file_binary_proto_def_proto_rawDescGZIP(), []int{7} } func (x *PaymentInviteMessage) GetServiceType() PaymentInviteMessage_ServiceType { @@ -4621,7 +4720,7 @@ type OrderMessage struct { func (x *OrderMessage) Reset() { *x = OrderMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[9] + mi := &file_binary_proto_def_proto_msgTypes[8] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4634,7 +4733,7 @@ func (x *OrderMessage) String() string { func (*OrderMessage) ProtoMessage() {} func (x *OrderMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[9] + mi := &file_binary_proto_def_proto_msgTypes[8] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4647,7 +4746,7 @@ func (x *OrderMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use OrderMessage.ProtoReflect.Descriptor instead. func (*OrderMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{9} + return file_binary_proto_def_proto_rawDescGZIP(), []int{8} } func (x *OrderMessage) GetOrderId() string { @@ -4756,7 +4855,7 @@ type LocationMessage struct { func (x *LocationMessage) Reset() { *x = LocationMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[10] + mi := &file_binary_proto_def_proto_msgTypes[9] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4769,7 +4868,7 @@ func (x *LocationMessage) String() string { func (*LocationMessage) ProtoMessage() {} func (x *LocationMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[10] + mi := &file_binary_proto_def_proto_msgTypes[9] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4782,7 +4881,7 @@ func (x *LocationMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use LocationMessage.ProtoReflect.Descriptor instead. func (*LocationMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{10} + return file_binary_proto_def_proto_rawDescGZIP(), []int{9} } func (x *LocationMessage) GetDegreesLatitude() float64 { @@ -4889,7 +4988,7 @@ type LiveLocationMessage struct { func (x *LiveLocationMessage) Reset() { *x = LiveLocationMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[11] + mi := &file_binary_proto_def_proto_msgTypes[10] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -4902,7 +5001,7 @@ func (x *LiveLocationMessage) String() string { func (*LiveLocationMessage) ProtoMessage() {} func (x *LiveLocationMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[11] + mi := &file_binary_proto_def_proto_msgTypes[10] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -4915,7 +5014,7 @@ func (x *LiveLocationMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use LiveLocationMessage.ProtoReflect.Descriptor instead. func (*LiveLocationMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{11} + return file_binary_proto_def_proto_rawDescGZIP(), []int{10} } func (x *LiveLocationMessage) GetDegreesLatitude() float64 { @@ -5003,7 +5102,7 @@ type ListResponseMessage struct { func (x *ListResponseMessage) Reset() { *x = ListResponseMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[12] + mi := &file_binary_proto_def_proto_msgTypes[11] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5016,7 +5115,7 @@ func (x *ListResponseMessage) String() string { func (*ListResponseMessage) ProtoMessage() {} func (x *ListResponseMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[12] + mi := &file_binary_proto_def_proto_msgTypes[11] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5029,7 +5128,7 @@ func (x *ListResponseMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ListResponseMessage.ProtoReflect.Descriptor instead. func (*ListResponseMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{12} + return file_binary_proto_def_proto_rawDescGZIP(), []int{11} } func (x *ListResponseMessage) GetTitle() string { @@ -5085,7 +5184,7 @@ type ListMessage struct { func (x *ListMessage) Reset() { *x = ListMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[13] + mi := &file_binary_proto_def_proto_msgTypes[12] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5098,7 +5197,7 @@ func (x *ListMessage) String() string { func (*ListMessage) ProtoMessage() {} func (x *ListMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[13] + mi := &file_binary_proto_def_proto_msgTypes[12] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5111,7 +5210,7 @@ func (x *ListMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ListMessage.ProtoReflect.Descriptor instead. func (*ListMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12} } func (x *ListMessage) GetTitle() string { @@ -5183,7 +5282,7 @@ type KeepInChatMessage struct { func (x *KeepInChatMessage) Reset() { *x = KeepInChatMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[14] + mi := &file_binary_proto_def_proto_msgTypes[13] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5196,7 +5295,7 @@ func (x *KeepInChatMessage) String() string { func (*KeepInChatMessage) ProtoMessage() {} func (x *KeepInChatMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[14] + mi := &file_binary_proto_def_proto_msgTypes[13] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5209,7 +5308,7 @@ func (x *KeepInChatMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use KeepInChatMessage.ProtoReflect.Descriptor instead. func (*KeepInChatMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{14} + return file_binary_proto_def_proto_rawDescGZIP(), []int{13} } func (x *KeepInChatMessage) GetKey() *MessageKey { @@ -5253,7 +5352,7 @@ type InvoiceMessage struct { func (x *InvoiceMessage) Reset() { *x = InvoiceMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[15] + mi := &file_binary_proto_def_proto_msgTypes[14] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5266,7 +5365,7 @@ func (x *InvoiceMessage) String() string { func (*InvoiceMessage) ProtoMessage() {} func (x *InvoiceMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[15] + mi := &file_binary_proto_def_proto_msgTypes[14] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5279,7 +5378,7 @@ func (x *InvoiceMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use InvoiceMessage.ProtoReflect.Descriptor instead. func (*InvoiceMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{15} + return file_binary_proto_def_proto_rawDescGZIP(), []int{14} } func (x *InvoiceMessage) GetNote() string { @@ -5368,7 +5467,7 @@ type InteractiveResponseMessage struct { func (x *InteractiveResponseMessage) Reset() { *x = InteractiveResponseMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[16] + mi := &file_binary_proto_def_proto_msgTypes[15] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5381,7 +5480,7 @@ func (x *InteractiveResponseMessage) String() string { func (*InteractiveResponseMessage) ProtoMessage() {} func (x *InteractiveResponseMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[16] + mi := &file_binary_proto_def_proto_msgTypes[15] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5394,7 +5493,7 @@ func (x *InteractiveResponseMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveResponseMessage.ProtoReflect.Descriptor instead. func (*InteractiveResponseMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{16} + return file_binary_proto_def_proto_rawDescGZIP(), []int{15} } func (x *InteractiveResponseMessage) GetBody() *InteractiveResponseMessage_Body { @@ -5456,7 +5555,7 @@ type InteractiveMessage struct { func (x *InteractiveMessage) Reset() { *x = InteractiveMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[17] + mi := &file_binary_proto_def_proto_msgTypes[16] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5469,7 +5568,7 @@ func (x *InteractiveMessage) String() string { func (*InteractiveMessage) ProtoMessage() {} func (x *InteractiveMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[17] + mi := &file_binary_proto_def_proto_msgTypes[16] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5482,7 +5581,7 @@ func (x *InteractiveMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveMessage.ProtoReflect.Descriptor instead. func (*InteractiveMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16} } func (x *InteractiveMessage) GetHeader() *InteractiveMessage_Header { @@ -5574,7 +5673,7 @@ type InitialSecurityNotificationSettingSync struct { func (x *InitialSecurityNotificationSettingSync) Reset() { *x = InitialSecurityNotificationSettingSync{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[18] + mi := &file_binary_proto_def_proto_msgTypes[17] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5587,7 +5686,7 @@ func (x *InitialSecurityNotificationSettingSync) String() string { func (*InitialSecurityNotificationSettingSync) ProtoMessage() {} func (x *InitialSecurityNotificationSettingSync) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[18] + mi := &file_binary_proto_def_proto_msgTypes[17] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5600,7 +5699,7 @@ func (x *InitialSecurityNotificationSettingSync) ProtoReflect() protoreflect.Mes // Deprecated: Use InitialSecurityNotificationSettingSync.ProtoReflect.Descriptor instead. func (*InitialSecurityNotificationSettingSync) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{18} + return file_binary_proto_def_proto_rawDescGZIP(), []int{17} } func (x *InitialSecurityNotificationSettingSync) GetSecurityNotificationEnabled() bool { @@ -5646,7 +5745,7 @@ type ImageMessage struct { func (x *ImageMessage) Reset() { *x = ImageMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[19] + mi := &file_binary_proto_def_proto_msgTypes[18] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5659,7 +5758,7 @@ func (x *ImageMessage) String() string { func (*ImageMessage) ProtoMessage() {} func (x *ImageMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[19] + mi := &file_binary_proto_def_proto_msgTypes[18] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5672,7 +5771,7 @@ func (x *ImageMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ImageMessage.ProtoReflect.Descriptor instead. func (*ImageMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{19} + return file_binary_proto_def_proto_rawDescGZIP(), []int{18} } func (x *ImageMessage) GetUrl() string { @@ -5877,7 +5976,7 @@ type HistorySyncNotification struct { func (x *HistorySyncNotification) Reset() { *x = HistorySyncNotification{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[20] + mi := &file_binary_proto_def_proto_msgTypes[19] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -5890,7 +5989,7 @@ func (x *HistorySyncNotification) String() string { func (*HistorySyncNotification) ProtoMessage() {} func (x *HistorySyncNotification) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[20] + mi := &file_binary_proto_def_proto_msgTypes[19] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -5903,7 +6002,7 @@ func (x *HistorySyncNotification) ProtoReflect() protoreflect.Message { // Deprecated: Use HistorySyncNotification.ProtoReflect.Descriptor instead. func (*HistorySyncNotification) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{20} + return file_binary_proto_def_proto_rawDescGZIP(), []int{19} } func (x *HistorySyncNotification) GetFileSha256() []byte { @@ -5995,7 +6094,7 @@ type HighlyStructuredMessage struct { func (x *HighlyStructuredMessage) Reset() { *x = HighlyStructuredMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[21] + mi := &file_binary_proto_def_proto_msgTypes[20] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6008,7 +6107,7 @@ func (x *HighlyStructuredMessage) String() string { func (*HighlyStructuredMessage) ProtoMessage() {} func (x *HighlyStructuredMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[21] + mi := &file_binary_proto_def_proto_msgTypes[20] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6021,7 +6120,7 @@ func (x *HighlyStructuredMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use HighlyStructuredMessage.ProtoReflect.Descriptor instead. func (*HighlyStructuredMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20} } func (x *HighlyStructuredMessage) GetNamespace() string { @@ -6105,7 +6204,7 @@ type GroupInviteMessage struct { func (x *GroupInviteMessage) Reset() { *x = GroupInviteMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[22] + mi := &file_binary_proto_def_proto_msgTypes[21] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6118,7 +6217,7 @@ func (x *GroupInviteMessage) String() string { func (*GroupInviteMessage) ProtoMessage() {} func (x *GroupInviteMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[22] + mi := &file_binary_proto_def_proto_msgTypes[21] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6131,7 +6230,7 @@ func (x *GroupInviteMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use GroupInviteMessage.ProtoReflect.Descriptor instead. func (*GroupInviteMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{22} + return file_binary_proto_def_proto_rawDescGZIP(), []int{21} } func (x *GroupInviteMessage) GetGroupJid() string { @@ -6201,7 +6300,7 @@ type FutureProofMessage struct { func (x *FutureProofMessage) Reset() { *x = FutureProofMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[23] + mi := &file_binary_proto_def_proto_msgTypes[22] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6214,7 +6313,7 @@ func (x *FutureProofMessage) String() string { func (*FutureProofMessage) ProtoMessage() {} func (x *FutureProofMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[23] + mi := &file_binary_proto_def_proto_msgTypes[22] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6227,7 +6326,7 @@ func (x *FutureProofMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use FutureProofMessage.ProtoReflect.Descriptor instead. func (*FutureProofMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{23} + return file_binary_proto_def_proto_rawDescGZIP(), []int{22} } func (x *FutureProofMessage) GetMessage() *Message { @@ -6271,7 +6370,7 @@ type ExtendedTextMessage struct { func (x *ExtendedTextMessage) Reset() { *x = ExtendedTextMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[24] + mi := &file_binary_proto_def_proto_msgTypes[23] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6284,7 +6383,7 @@ func (x *ExtendedTextMessage) String() string { func (*ExtendedTextMessage) ProtoMessage() {} func (x *ExtendedTextMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[24] + mi := &file_binary_proto_def_proto_msgTypes[23] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6297,7 +6396,7 @@ func (x *ExtendedTextMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ExtendedTextMessage.ProtoReflect.Descriptor instead. func (*ExtendedTextMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{24} + return file_binary_proto_def_proto_rawDescGZIP(), []int{23} } func (x *ExtendedTextMessage) GetText() string { @@ -6481,7 +6580,7 @@ type EncReactionMessage struct { func (x *EncReactionMessage) Reset() { *x = EncReactionMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[25] + mi := &file_binary_proto_def_proto_msgTypes[24] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6494,7 +6593,7 @@ func (x *EncReactionMessage) String() string { func (*EncReactionMessage) ProtoMessage() {} func (x *EncReactionMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[25] + mi := &file_binary_proto_def_proto_msgTypes[24] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6507,7 +6606,7 @@ func (x *EncReactionMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use EncReactionMessage.ProtoReflect.Descriptor instead. func (*EncReactionMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{25} + return file_binary_proto_def_proto_rawDescGZIP(), []int{24} } func (x *EncReactionMessage) GetTargetMessageKey() *MessageKey { @@ -6561,7 +6660,7 @@ type DocumentMessage struct { func (x *DocumentMessage) Reset() { *x = DocumentMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[26] + mi := &file_binary_proto_def_proto_msgTypes[25] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6574,7 +6673,7 @@ func (x *DocumentMessage) String() string { func (*DocumentMessage) ProtoMessage() {} func (x *DocumentMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[26] + mi := &file_binary_proto_def_proto_msgTypes[25] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6587,7 +6686,7 @@ func (x *DocumentMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use DocumentMessage.ProtoReflect.Descriptor instead. func (*DocumentMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{26} + return file_binary_proto_def_proto_rawDescGZIP(), []int{25} } func (x *DocumentMessage) GetUrl() string { @@ -6743,7 +6842,7 @@ type DeviceSentMessage struct { func (x *DeviceSentMessage) Reset() { *x = DeviceSentMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[27] + mi := &file_binary_proto_def_proto_msgTypes[26] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6756,7 +6855,7 @@ func (x *DeviceSentMessage) String() string { func (*DeviceSentMessage) ProtoMessage() {} func (x *DeviceSentMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[27] + mi := &file_binary_proto_def_proto_msgTypes[26] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6769,7 +6868,7 @@ func (x *DeviceSentMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use DeviceSentMessage.ProtoReflect.Descriptor instead. func (*DeviceSentMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{27} + return file_binary_proto_def_proto_rawDescGZIP(), []int{26} } func (x *DeviceSentMessage) GetDestinationJid() string { @@ -6804,7 +6903,7 @@ type DeclinePaymentRequestMessage struct { func (x *DeclinePaymentRequestMessage) Reset() { *x = DeclinePaymentRequestMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[28] + mi := &file_binary_proto_def_proto_msgTypes[27] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6817,7 +6916,7 @@ func (x *DeclinePaymentRequestMessage) String() string { func (*DeclinePaymentRequestMessage) ProtoMessage() {} func (x *DeclinePaymentRequestMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[28] + mi := &file_binary_proto_def_proto_msgTypes[27] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6830,7 +6929,7 @@ func (x *DeclinePaymentRequestMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use DeclinePaymentRequestMessage.ProtoReflect.Descriptor instead. func (*DeclinePaymentRequestMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{28} + return file_binary_proto_def_proto_rawDescGZIP(), []int{27} } func (x *DeclinePaymentRequestMessage) GetKey() *MessageKey { @@ -6853,7 +6952,7 @@ type ContactsArrayMessage struct { func (x *ContactsArrayMessage) Reset() { *x = ContactsArrayMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[29] + mi := &file_binary_proto_def_proto_msgTypes[28] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6866,7 +6965,7 @@ func (x *ContactsArrayMessage) String() string { func (*ContactsArrayMessage) ProtoMessage() {} func (x *ContactsArrayMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[29] + mi := &file_binary_proto_def_proto_msgTypes[28] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6879,7 +6978,7 @@ func (x *ContactsArrayMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ContactsArrayMessage.ProtoReflect.Descriptor instead. func (*ContactsArrayMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{29} + return file_binary_proto_def_proto_rawDescGZIP(), []int{28} } func (x *ContactsArrayMessage) GetDisplayName() string { @@ -6916,7 +7015,7 @@ type ContactMessage struct { func (x *ContactMessage) Reset() { *x = ContactMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[30] + mi := &file_binary_proto_def_proto_msgTypes[29] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6929,7 +7028,7 @@ func (x *ContactMessage) String() string { func (*ContactMessage) ProtoMessage() {} func (x *ContactMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[30] + mi := &file_binary_proto_def_proto_msgTypes[29] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -6942,7 +7041,7 @@ func (x *ContactMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ContactMessage.ProtoReflect.Descriptor instead. func (*ContactMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{30} + return file_binary_proto_def_proto_rawDescGZIP(), []int{29} } func (x *ContactMessage) GetDisplayName() string { @@ -6978,7 +7077,7 @@ type Chat struct { func (x *Chat) Reset() { *x = Chat{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[31] + mi := &file_binary_proto_def_proto_msgTypes[30] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -6991,7 +7090,7 @@ func (x *Chat) String() string { func (*Chat) ProtoMessage() {} func (x *Chat) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[31] + mi := &file_binary_proto_def_proto_msgTypes[30] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7004,7 +7103,7 @@ func (x *Chat) ProtoReflect() protoreflect.Message { // Deprecated: Use Chat.ProtoReflect.Descriptor instead. func (*Chat) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{31} + return file_binary_proto_def_proto_rawDescGZIP(), []int{30} } func (x *Chat) GetDisplayName() string { @@ -7032,7 +7131,7 @@ type CancelPaymentRequestMessage struct { func (x *CancelPaymentRequestMessage) Reset() { *x = CancelPaymentRequestMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[32] + mi := &file_binary_proto_def_proto_msgTypes[31] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7045,7 +7144,7 @@ func (x *CancelPaymentRequestMessage) String() string { func (*CancelPaymentRequestMessage) ProtoMessage() {} func (x *CancelPaymentRequestMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[32] + mi := &file_binary_proto_def_proto_msgTypes[31] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7058,7 +7157,7 @@ func (x *CancelPaymentRequestMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use CancelPaymentRequestMessage.ProtoReflect.Descriptor instead. func (*CancelPaymentRequestMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{32} + return file_binary_proto_def_proto_rawDescGZIP(), []int{31} } func (x *CancelPaymentRequestMessage) GetKey() *MessageKey { @@ -7082,7 +7181,7 @@ type Call struct { func (x *Call) Reset() { *x = Call{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[33] + mi := &file_binary_proto_def_proto_msgTypes[32] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7095,7 +7194,7 @@ func (x *Call) String() string { func (*Call) ProtoMessage() {} func (x *Call) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[33] + mi := &file_binary_proto_def_proto_msgTypes[32] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7108,7 +7207,7 @@ func (x *Call) ProtoReflect() protoreflect.Message { // Deprecated: Use Call.ProtoReflect.Descriptor instead. func (*Call) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{33} + return file_binary_proto_def_proto_rawDescGZIP(), []int{32} } func (x *Call) GetCallKey() []byte { @@ -7156,7 +7255,7 @@ type ButtonsResponseMessage struct { func (x *ButtonsResponseMessage) Reset() { *x = ButtonsResponseMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[34] + mi := &file_binary_proto_def_proto_msgTypes[33] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7169,7 +7268,7 @@ func (x *ButtonsResponseMessage) String() string { func (*ButtonsResponseMessage) ProtoMessage() {} func (x *ButtonsResponseMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[34] + mi := &file_binary_proto_def_proto_msgTypes[33] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7182,7 +7281,7 @@ func (x *ButtonsResponseMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ButtonsResponseMessage.ProtoReflect.Descriptor instead. func (*ButtonsResponseMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{34} + return file_binary_proto_def_proto_rawDescGZIP(), []int{33} } func (x *ButtonsResponseMessage) GetSelectedButtonId() string { @@ -7253,7 +7352,7 @@ type ButtonsMessage struct { func (x *ButtonsMessage) Reset() { *x = ButtonsMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[35] + mi := &file_binary_proto_def_proto_msgTypes[34] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7266,7 +7365,7 @@ func (x *ButtonsMessage) String() string { func (*ButtonsMessage) ProtoMessage() {} func (x *ButtonsMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[35] + mi := &file_binary_proto_def_proto_msgTypes[34] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7279,7 +7378,7 @@ func (x *ButtonsMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ButtonsMessage.ProtoReflect.Descriptor instead. func (*ButtonsMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{35} + return file_binary_proto_def_proto_rawDescGZIP(), []int{34} } func (x *ButtonsMessage) GetContentText() string { @@ -7412,12 +7511,13 @@ type AudioMessage struct { StreamingSidecar []byte `protobuf:"bytes,18,opt,name=streamingSidecar" json:"streamingSidecar,omitempty"` Waveform []byte `protobuf:"bytes,19,opt,name=waveform" json:"waveform,omitempty"` BackgroundArgb *uint32 `protobuf:"fixed32,20,opt,name=backgroundArgb" json:"backgroundArgb,omitempty"` + ViewOnce *bool `protobuf:"varint,21,opt,name=viewOnce" json:"viewOnce,omitempty"` } func (x *AudioMessage) Reset() { *x = AudioMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[36] + mi := &file_binary_proto_def_proto_msgTypes[35] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7430,7 +7530,7 @@ func (x *AudioMessage) String() string { func (*AudioMessage) ProtoMessage() {} func (x *AudioMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[36] + mi := &file_binary_proto_def_proto_msgTypes[35] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7443,7 +7543,7 @@ func (x *AudioMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use AudioMessage.ProtoReflect.Descriptor instead. func (*AudioMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{36} + return file_binary_proto_def_proto_rawDescGZIP(), []int{35} } func (x *AudioMessage) GetUrl() string { @@ -7544,6 +7644,13 @@ func (x *AudioMessage) GetBackgroundArgb() uint32 { return 0 } +func (x *AudioMessage) GetViewOnce() bool { + if x != nil && x.ViewOnce != nil { + return *x.ViewOnce + } + return false +} + type AppStateSyncKey struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -7556,7 +7663,7 @@ type AppStateSyncKey struct { func (x *AppStateSyncKey) Reset() { *x = AppStateSyncKey{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[37] + mi := &file_binary_proto_def_proto_msgTypes[36] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7569,7 +7676,7 @@ func (x *AppStateSyncKey) String() string { func (*AppStateSyncKey) ProtoMessage() {} func (x *AppStateSyncKey) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[37] + mi := &file_binary_proto_def_proto_msgTypes[36] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7582,7 +7689,7 @@ func (x *AppStateSyncKey) ProtoReflect() protoreflect.Message { // Deprecated: Use AppStateSyncKey.ProtoReflect.Descriptor instead. func (*AppStateSyncKey) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{37} + return file_binary_proto_def_proto_rawDescGZIP(), []int{36} } func (x *AppStateSyncKey) GetKeyId() *AppStateSyncKeyId { @@ -7610,7 +7717,7 @@ type AppStateSyncKeyShare struct { func (x *AppStateSyncKeyShare) Reset() { *x = AppStateSyncKeyShare{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[38] + mi := &file_binary_proto_def_proto_msgTypes[37] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7623,7 +7730,7 @@ func (x *AppStateSyncKeyShare) String() string { func (*AppStateSyncKeyShare) ProtoMessage() {} func (x *AppStateSyncKeyShare) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[38] + mi := &file_binary_proto_def_proto_msgTypes[37] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7636,7 +7743,7 @@ func (x *AppStateSyncKeyShare) ProtoReflect() protoreflect.Message { // Deprecated: Use AppStateSyncKeyShare.ProtoReflect.Descriptor instead. func (*AppStateSyncKeyShare) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{38} + return file_binary_proto_def_proto_rawDescGZIP(), []int{37} } func (x *AppStateSyncKeyShare) GetKeys() []*AppStateSyncKey { @@ -7657,7 +7764,7 @@ type AppStateSyncKeyRequest struct { func (x *AppStateSyncKeyRequest) Reset() { *x = AppStateSyncKeyRequest{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[39] + mi := &file_binary_proto_def_proto_msgTypes[38] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7670,7 +7777,7 @@ func (x *AppStateSyncKeyRequest) String() string { func (*AppStateSyncKeyRequest) ProtoMessage() {} func (x *AppStateSyncKeyRequest) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[39] + mi := &file_binary_proto_def_proto_msgTypes[38] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7683,7 +7790,7 @@ func (x *AppStateSyncKeyRequest) ProtoReflect() protoreflect.Message { // Deprecated: Use AppStateSyncKeyRequest.ProtoReflect.Descriptor instead. func (*AppStateSyncKeyRequest) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{39} + return file_binary_proto_def_proto_rawDescGZIP(), []int{38} } func (x *AppStateSyncKeyRequest) GetKeyIds() []*AppStateSyncKeyId { @@ -7704,7 +7811,7 @@ type AppStateSyncKeyId struct { func (x *AppStateSyncKeyId) Reset() { *x = AppStateSyncKeyId{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[40] + mi := &file_binary_proto_def_proto_msgTypes[39] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7717,7 +7824,7 @@ func (x *AppStateSyncKeyId) String() string { func (*AppStateSyncKeyId) ProtoMessage() {} func (x *AppStateSyncKeyId) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[40] + mi := &file_binary_proto_def_proto_msgTypes[39] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7730,7 +7837,7 @@ func (x *AppStateSyncKeyId) ProtoReflect() protoreflect.Message { // Deprecated: Use AppStateSyncKeyId.ProtoReflect.Descriptor instead. func (*AppStateSyncKeyId) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{40} + return file_binary_proto_def_proto_rawDescGZIP(), []int{39} } func (x *AppStateSyncKeyId) GetKeyId() []byte { @@ -7753,7 +7860,7 @@ type AppStateSyncKeyFingerprint struct { func (x *AppStateSyncKeyFingerprint) Reset() { *x = AppStateSyncKeyFingerprint{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[41] + mi := &file_binary_proto_def_proto_msgTypes[40] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7766,7 +7873,7 @@ func (x *AppStateSyncKeyFingerprint) String() string { func (*AppStateSyncKeyFingerprint) ProtoMessage() {} func (x *AppStateSyncKeyFingerprint) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[41] + mi := &file_binary_proto_def_proto_msgTypes[40] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7779,7 +7886,7 @@ func (x *AppStateSyncKeyFingerprint) ProtoReflect() protoreflect.Message { // Deprecated: Use AppStateSyncKeyFingerprint.ProtoReflect.Descriptor instead. func (*AppStateSyncKeyFingerprint) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{41} + return file_binary_proto_def_proto_rawDescGZIP(), []int{40} } func (x *AppStateSyncKeyFingerprint) GetRawId() uint32 { @@ -7816,7 +7923,7 @@ type AppStateSyncKeyData struct { func (x *AppStateSyncKeyData) Reset() { *x = AppStateSyncKeyData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[42] + mi := &file_binary_proto_def_proto_msgTypes[41] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7829,7 +7936,7 @@ func (x *AppStateSyncKeyData) String() string { func (*AppStateSyncKeyData) ProtoMessage() {} func (x *AppStateSyncKeyData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[42] + mi := &file_binary_proto_def_proto_msgTypes[41] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7842,7 +7949,7 @@ func (x *AppStateSyncKeyData) ProtoReflect() protoreflect.Message { // Deprecated: Use AppStateSyncKeyData.ProtoReflect.Descriptor instead. func (*AppStateSyncKeyData) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{42} + return file_binary_proto_def_proto_rawDescGZIP(), []int{41} } func (x *AppStateSyncKeyData) GetKeyData() []byte { @@ -7878,7 +7985,7 @@ type AppStateFatalExceptionNotification struct { func (x *AppStateFatalExceptionNotification) Reset() { *x = AppStateFatalExceptionNotification{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[43] + mi := &file_binary_proto_def_proto_msgTypes[42] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7891,7 +7998,7 @@ func (x *AppStateFatalExceptionNotification) String() string { func (*AppStateFatalExceptionNotification) ProtoMessage() {} func (x *AppStateFatalExceptionNotification) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[43] + mi := &file_binary_proto_def_proto_msgTypes[42] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7904,7 +8011,7 @@ func (x *AppStateFatalExceptionNotification) ProtoReflect() protoreflect.Message // Deprecated: Use AppStateFatalExceptionNotification.ProtoReflect.Descriptor instead. func (*AppStateFatalExceptionNotification) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{43} + return file_binary_proto_def_proto_rawDescGZIP(), []int{42} } func (x *AppStateFatalExceptionNotification) GetCollectionNames() []string { @@ -7934,7 +8041,7 @@ type Location struct { func (x *Location) Reset() { *x = Location{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[44] + mi := &file_binary_proto_def_proto_msgTypes[43] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -7947,7 +8054,7 @@ func (x *Location) String() string { func (*Location) ProtoMessage() {} func (x *Location) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[44] + mi := &file_binary_proto_def_proto_msgTypes[43] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -7960,7 +8067,7 @@ func (x *Location) ProtoReflect() protoreflect.Message { // Deprecated: Use Location.ProtoReflect.Descriptor instead. func (*Location) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{44} + return file_binary_proto_def_proto_rawDescGZIP(), []int{43} } func (x *Location) GetDegreesLatitude() float64 { @@ -7999,7 +8106,7 @@ type InteractiveAnnotation struct { func (x *InteractiveAnnotation) Reset() { *x = InteractiveAnnotation{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[45] + mi := &file_binary_proto_def_proto_msgTypes[44] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -8012,7 +8119,7 @@ func (x *InteractiveAnnotation) String() string { func (*InteractiveAnnotation) ProtoMessage() {} func (x *InteractiveAnnotation) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[45] + mi := &file_binary_proto_def_proto_msgTypes[44] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -8025,7 +8132,7 @@ func (x *InteractiveAnnotation) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveAnnotation.ProtoReflect.Descriptor instead. func (*InteractiveAnnotation) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{45} + return file_binary_proto_def_proto_rawDescGZIP(), []int{44} } func (x *InteractiveAnnotation) GetPolygonVertices() []*Point { @@ -8076,7 +8183,7 @@ type HydratedTemplateButton struct { func (x *HydratedTemplateButton) Reset() { *x = HydratedTemplateButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[46] + mi := &file_binary_proto_def_proto_msgTypes[45] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -8089,7 +8196,7 @@ func (x *HydratedTemplateButton) String() string { func (*HydratedTemplateButton) ProtoMessage() {} func (x *HydratedTemplateButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[46] + mi := &file_binary_proto_def_proto_msgTypes[45] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -8102,7 +8209,7 @@ func (x *HydratedTemplateButton) ProtoReflect() protoreflect.Message { // Deprecated: Use HydratedTemplateButton.ProtoReflect.Descriptor instead. func (*HydratedTemplateButton) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{46} + return file_binary_proto_def_proto_rawDescGZIP(), []int{45} } func (x *HydratedTemplateButton) GetIndex() uint32 { @@ -8162,6 +8269,61 @@ func (*HydratedTemplateButton_UrlButton) isHydratedTemplateButton_HydratedButton func (*HydratedTemplateButton_CallButton) isHydratedTemplateButton_HydratedButton() {} +type GroupMention struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + GroupJid *string `protobuf:"bytes,1,opt,name=groupJid" json:"groupJid,omitempty"` + GroupSubject *string `protobuf:"bytes,2,opt,name=groupSubject" json:"groupSubject,omitempty"` +} + +func (x *GroupMention) Reset() { + *x = GroupMention{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[46] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *GroupMention) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*GroupMention) ProtoMessage() {} + +func (x *GroupMention) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[46] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use GroupMention.ProtoReflect.Descriptor instead. +func (*GroupMention) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{46} +} + +func (x *GroupMention) GetGroupJid() string { + if x != nil && x.GroupJid != nil { + return *x.GroupJid + } + return "" +} + +func (x *GroupMention) GetGroupSubject() string { + if x != nil && x.GroupSubject != nil { + return *x.GroupSubject + } + return "" +} + type DisappearingMode struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -8327,6 +8489,8 @@ type ContextInfo struct { TrustBannerType *string `protobuf:"bytes,37,opt,name=trustBannerType" json:"trustBannerType,omitempty"` TrustBannerAction *uint32 `protobuf:"varint,38,opt,name=trustBannerAction" json:"trustBannerAction,omitempty"` IsSampled *bool `protobuf:"varint,39,opt,name=isSampled" json:"isSampled,omitempty"` + GroupMentions []*GroupMention `protobuf:"bytes,40,rep,name=groupMentions" json:"groupMentions,omitempty"` + Utm *ContextInfo_UTMInfo `protobuf:"bytes,41,opt,name=utm" json:"utm,omitempty"` } func (x *ContextInfo) Reset() { @@ -8543,6 +8707,20 @@ func (x *ContextInfo) GetIsSampled() bool { return false } +func (x *ContextInfo) GetGroupMentions() []*GroupMention { + if x != nil { + return x.GroupMentions + } + return nil +} + +func (x *ContextInfo) GetUtm() *ContextInfo_UTMInfo { + if x != nil { + return x.Utm + } + return nil +} + type ActionLink struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -9009,6 +9187,12 @@ type Message struct { EditedMessage *FutureProofMessage `protobuf:"bytes,58,opt,name=editedMessage" json:"editedMessage,omitempty"` ViewOnceMessageV2Extension *FutureProofMessage `protobuf:"bytes,59,opt,name=viewOnceMessageV2Extension" json:"viewOnceMessageV2Extension,omitempty"` PollCreationMessageV2 *PollCreationMessage `protobuf:"bytes,60,opt,name=pollCreationMessageV2" json:"pollCreationMessageV2,omitempty"` + ScheduledCallCreationMessage *ScheduledCallCreationMessage `protobuf:"bytes,61,opt,name=scheduledCallCreationMessage" json:"scheduledCallCreationMessage,omitempty"` + GroupMentionedMessage *FutureProofMessage `protobuf:"bytes,62,opt,name=groupMentionedMessage" json:"groupMentionedMessage,omitempty"` + PinMessage *PinMessage `protobuf:"bytes,63,opt,name=pinMessage" json:"pinMessage,omitempty"` + PollCreationMessageV3 *PollCreationMessage `protobuf:"bytes,64,opt,name=pollCreationMessageV3" json:"pollCreationMessageV3,omitempty"` + ScheduledCallEditMessage *ScheduledCallEditMessage `protobuf:"bytes,65,opt,name=scheduledCallEditMessage" json:"scheduledCallEditMessage,omitempty"` + PtvMessage *VideoMessage `protobuf:"bytes,66,opt,name=ptvMessage" json:"ptvMessage,omitempty"` } func (x *Message) Reset() { @@ -9393,6 +9577,48 @@ func (x *Message) GetPollCreationMessageV2() *PollCreationMessage { return nil } +func (x *Message) GetScheduledCallCreationMessage() *ScheduledCallCreationMessage { + if x != nil { + return x.ScheduledCallCreationMessage + } + return nil +} + +func (x *Message) GetGroupMentionedMessage() *FutureProofMessage { + if x != nil { + return x.GroupMentionedMessage + } + return nil +} + +func (x *Message) GetPinMessage() *PinMessage { + if x != nil { + return x.PinMessage + } + return nil +} + +func (x *Message) GetPollCreationMessageV3() *PollCreationMessage { + if x != nil { + return x.PollCreationMessageV3 + } + return nil +} + +func (x *Message) GetScheduledCallEditMessage() *ScheduledCallEditMessage { + if x != nil { + return x.ScheduledCallEditMessage + } + return nil +} + +func (x *Message) GetPtvMessage() *VideoMessage { + if x != nil { + return x.PtvMessage + } + return nil +} + type MessageContextInfo struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -10233,6 +10459,124 @@ func (x *SendPaymentMessage) GetBackground() *PaymentBackground { return nil } +type ScheduledCallEditMessage struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Key *MessageKey `protobuf:"bytes,1,opt,name=key" json:"key,omitempty"` + EditType *ScheduledCallEditMessage_EditType `protobuf:"varint,2,opt,name=editType,enum=proto.ScheduledCallEditMessage_EditType" json:"editType,omitempty"` +} + +func (x *ScheduledCallEditMessage) Reset() { + *x = ScheduledCallEditMessage{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[64] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *ScheduledCallEditMessage) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*ScheduledCallEditMessage) ProtoMessage() {} + +func (x *ScheduledCallEditMessage) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[64] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use ScheduledCallEditMessage.ProtoReflect.Descriptor instead. +func (*ScheduledCallEditMessage) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{64} +} + +func (x *ScheduledCallEditMessage) GetKey() *MessageKey { + if x != nil { + return x.Key + } + return nil +} + +func (x *ScheduledCallEditMessage) GetEditType() ScheduledCallEditMessage_EditType { + if x != nil && x.EditType != nil { + return *x.EditType + } + return ScheduledCallEditMessage_UNKNOWN +} + +type ScheduledCallCreationMessage struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + ScheduledTimestampMs *int64 `protobuf:"varint,1,opt,name=scheduledTimestampMs" json:"scheduledTimestampMs,omitempty"` + CallType *ScheduledCallCreationMessage_CallType `protobuf:"varint,2,opt,name=callType,enum=proto.ScheduledCallCreationMessage_CallType" json:"callType,omitempty"` + Title *string `protobuf:"bytes,3,opt,name=title" json:"title,omitempty"` +} + +func (x *ScheduledCallCreationMessage) Reset() { + *x = ScheduledCallCreationMessage{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[65] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *ScheduledCallCreationMessage) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*ScheduledCallCreationMessage) ProtoMessage() {} + +func (x *ScheduledCallCreationMessage) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[65] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use ScheduledCallCreationMessage.ProtoReflect.Descriptor instead. +func (*ScheduledCallCreationMessage) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{65} +} + +func (x *ScheduledCallCreationMessage) GetScheduledTimestampMs() int64 { + if x != nil && x.ScheduledTimestampMs != nil { + return *x.ScheduledTimestampMs + } + return 0 +} + +func (x *ScheduledCallCreationMessage) GetCallType() ScheduledCallCreationMessage_CallType { + if x != nil && x.CallType != nil { + return *x.CallType + } + return ScheduledCallCreationMessage_UNKNOWN +} + +func (x *ScheduledCallCreationMessage) GetTitle() string { + if x != nil && x.Title != nil { + return *x.Title + } + return "" +} + type RequestPhoneNumberMessage struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -10244,7 +10588,7 @@ type RequestPhoneNumberMessage struct { func (x *RequestPhoneNumberMessage) Reset() { *x = RequestPhoneNumberMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[64] + mi := &file_binary_proto_def_proto_msgTypes[66] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10257,7 +10601,7 @@ func (x *RequestPhoneNumberMessage) String() string { func (*RequestPhoneNumberMessage) ProtoMessage() {} func (x *RequestPhoneNumberMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[64] + mi := &file_binary_proto_def_proto_msgTypes[66] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10270,7 +10614,7 @@ func (x *RequestPhoneNumberMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use RequestPhoneNumberMessage.ProtoReflect.Descriptor instead. func (*RequestPhoneNumberMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{64} + return file_binary_proto_def_proto_rawDescGZIP(), []int{66} } func (x *RequestPhoneNumberMessage) GetContextInfo() *ContextInfo { @@ -10297,7 +10641,7 @@ type RequestPaymentMessage struct { func (x *RequestPaymentMessage) Reset() { *x = RequestPaymentMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[65] + mi := &file_binary_proto_def_proto_msgTypes[67] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10310,7 +10654,7 @@ func (x *RequestPaymentMessage) String() string { func (*RequestPaymentMessage) ProtoMessage() {} func (x *RequestPaymentMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[65] + mi := &file_binary_proto_def_proto_msgTypes[67] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10323,7 +10667,7 @@ func (x *RequestPaymentMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use RequestPaymentMessage.ProtoReflect.Descriptor instead. func (*RequestPaymentMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{65} + return file_binary_proto_def_proto_rawDescGZIP(), []int{67} } func (x *RequestPaymentMessage) GetNoteMessage() *Message { @@ -10389,7 +10733,7 @@ type ReactionMessage struct { func (x *ReactionMessage) Reset() { *x = ReactionMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[66] + mi := &file_binary_proto_def_proto_msgTypes[68] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10402,7 +10746,7 @@ func (x *ReactionMessage) String() string { func (*ReactionMessage) ProtoMessage() {} func (x *ReactionMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[66] + mi := &file_binary_proto_def_proto_msgTypes[68] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10415,7 +10759,7 @@ func (x *ReactionMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ReactionMessage.ProtoReflect.Descriptor instead. func (*ReactionMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{66} + return file_binary_proto_def_proto_rawDescGZIP(), []int{68} } func (x *ReactionMessage) GetKey() *MessageKey { @@ -10470,7 +10814,7 @@ type ProtocolMessage struct { func (x *ProtocolMessage) Reset() { *x = ProtocolMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[67] + mi := &file_binary_proto_def_proto_msgTypes[69] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10483,7 +10827,7 @@ func (x *ProtocolMessage) String() string { func (*ProtocolMessage) ProtoMessage() {} func (x *ProtocolMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[67] + mi := &file_binary_proto_def_proto_msgTypes[69] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10496,7 +10840,7 @@ func (x *ProtocolMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ProtocolMessage.ProtoReflect.Descriptor instead. func (*ProtocolMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{67} + return file_binary_proto_def_proto_rawDescGZIP(), []int{69} } func (x *ProtocolMessage) GetKey() *MessageKey { @@ -10613,7 +10957,7 @@ type ProductMessage struct { func (x *ProductMessage) Reset() { *x = ProductMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[68] + mi := &file_binary_proto_def_proto_msgTypes[70] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10626,7 +10970,7 @@ func (x *ProductMessage) String() string { func (*ProductMessage) ProtoMessage() {} func (x *ProductMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[68] + mi := &file_binary_proto_def_proto_msgTypes[70] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10639,7 +10983,7 @@ func (x *ProductMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use ProductMessage.ProtoReflect.Descriptor instead. func (*ProductMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{68} + return file_binary_proto_def_proto_rawDescGZIP(), []int{70} } func (x *ProductMessage) GetProduct() *ProductMessage_ProductSnapshot { @@ -10695,7 +11039,7 @@ type PollVoteMessage struct { func (x *PollVoteMessage) Reset() { *x = PollVoteMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[69] + mi := &file_binary_proto_def_proto_msgTypes[71] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10708,7 +11052,7 @@ func (x *PollVoteMessage) String() string { func (*PollVoteMessage) ProtoMessage() {} func (x *PollVoteMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[69] + mi := &file_binary_proto_def_proto_msgTypes[71] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10721,7 +11065,7 @@ func (x *PollVoteMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use PollVoteMessage.ProtoReflect.Descriptor instead. func (*PollVoteMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{69} + return file_binary_proto_def_proto_rawDescGZIP(), []int{71} } func (x *PollVoteMessage) GetSelectedOptions() [][]byte { @@ -10745,7 +11089,7 @@ type PollUpdateMessage struct { func (x *PollUpdateMessage) Reset() { *x = PollUpdateMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[70] + mi := &file_binary_proto_def_proto_msgTypes[72] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10758,7 +11102,7 @@ func (x *PollUpdateMessage) String() string { func (*PollUpdateMessage) ProtoMessage() {} func (x *PollUpdateMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[70] + mi := &file_binary_proto_def_proto_msgTypes[72] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10771,7 +11115,7 @@ func (x *PollUpdateMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use PollUpdateMessage.ProtoReflect.Descriptor instead. func (*PollUpdateMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{70} + return file_binary_proto_def_proto_rawDescGZIP(), []int{72} } func (x *PollUpdateMessage) GetPollCreationMessageKey() *MessageKey { @@ -10811,7 +11155,7 @@ type PollUpdateMessageMetadata struct { func (x *PollUpdateMessageMetadata) Reset() { *x = PollUpdateMessageMetadata{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[71] + mi := &file_binary_proto_def_proto_msgTypes[73] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10824,7 +11168,7 @@ func (x *PollUpdateMessageMetadata) String() string { func (*PollUpdateMessageMetadata) ProtoMessage() {} func (x *PollUpdateMessageMetadata) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[71] + mi := &file_binary_proto_def_proto_msgTypes[73] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10837,7 +11181,7 @@ func (x *PollUpdateMessageMetadata) ProtoReflect() protoreflect.Message { // Deprecated: Use PollUpdateMessageMetadata.ProtoReflect.Descriptor instead. func (*PollUpdateMessageMetadata) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{71} + return file_binary_proto_def_proto_rawDescGZIP(), []int{73} } type PollEncValue struct { @@ -10852,7 +11196,7 @@ type PollEncValue struct { func (x *PollEncValue) Reset() { *x = PollEncValue{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[72] + mi := &file_binary_proto_def_proto_msgTypes[74] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10865,7 +11209,7 @@ func (x *PollEncValue) String() string { func (*PollEncValue) ProtoMessage() {} func (x *PollEncValue) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[72] + mi := &file_binary_proto_def_proto_msgTypes[74] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10878,7 +11222,7 @@ func (x *PollEncValue) ProtoReflect() protoreflect.Message { // Deprecated: Use PollEncValue.ProtoReflect.Descriptor instead. func (*PollEncValue) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{72} + return file_binary_proto_def_proto_rawDescGZIP(), []int{74} } func (x *PollEncValue) GetEncPayload() []byte { @@ -10910,7 +11254,7 @@ type PollCreationMessage struct { func (x *PollCreationMessage) Reset() { *x = PollCreationMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[73] + mi := &file_binary_proto_def_proto_msgTypes[75] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10923,7 +11267,7 @@ func (x *PollCreationMessage) String() string { func (*PollCreationMessage) ProtoMessage() {} func (x *PollCreationMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[73] + mi := &file_binary_proto_def_proto_msgTypes[75] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -10936,7 +11280,7 @@ func (x *PollCreationMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use PollCreationMessage.ProtoReflect.Descriptor instead. func (*PollCreationMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{73} + return file_binary_proto_def_proto_rawDescGZIP(), []int{75} } func (x *PollCreationMessage) GetEncKey() []byte { @@ -10974,6 +11318,132 @@ func (x *PollCreationMessage) GetContextInfo() *ContextInfo { return nil } +type PinMessage struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Key *MessageKey `protobuf:"bytes,1,opt,name=key" json:"key,omitempty"` + PinMessageType *PinMessage_PinMessageType `protobuf:"varint,2,opt,name=pinMessageType,enum=proto.PinMessage_PinMessageType" json:"pinMessageType,omitempty"` + SenderTimestampMs *int64 `protobuf:"varint,3,opt,name=senderTimestampMs" json:"senderTimestampMs,omitempty"` +} + +func (x *PinMessage) Reset() { + *x = PinMessage{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[76] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *PinMessage) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*PinMessage) ProtoMessage() {} + +func (x *PinMessage) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[76] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use PinMessage.ProtoReflect.Descriptor instead. +func (*PinMessage) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{76} +} + +func (x *PinMessage) GetKey() *MessageKey { + if x != nil { + return x.Key + } + return nil +} + +func (x *PinMessage) GetPinMessageType() PinMessage_PinMessageType { + if x != nil && x.PinMessageType != nil { + return *x.PinMessageType + } + return PinMessage_UNKNOWN_PIN_MESSAGE_TYPE +} + +func (x *PinMessage) GetSenderTimestampMs() int64 { + if x != nil && x.SenderTimestampMs != nil { + return *x.SenderTimestampMs + } + return 0 +} + +type PeerDataOperationRequestResponseMessage struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + PeerDataOperationRequestType *PeerDataOperationRequestType `protobuf:"varint,1,opt,name=peerDataOperationRequestType,enum=proto.PeerDataOperationRequestType" json:"peerDataOperationRequestType,omitempty"` + StanzaId *string `protobuf:"bytes,2,opt,name=stanzaId" json:"stanzaId,omitempty"` + PeerDataOperationResult []*PeerDataOperationRequestResponseMessage_PeerDataOperationResult `protobuf:"bytes,3,rep,name=peerDataOperationResult" json:"peerDataOperationResult,omitempty"` +} + +func (x *PeerDataOperationRequestResponseMessage) Reset() { + *x = PeerDataOperationRequestResponseMessage{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[77] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *PeerDataOperationRequestResponseMessage) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*PeerDataOperationRequestResponseMessage) ProtoMessage() {} + +func (x *PeerDataOperationRequestResponseMessage) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[77] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use PeerDataOperationRequestResponseMessage.ProtoReflect.Descriptor instead. +func (*PeerDataOperationRequestResponseMessage) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{77} +} + +func (x *PeerDataOperationRequestResponseMessage) GetPeerDataOperationRequestType() PeerDataOperationRequestType { + if x != nil && x.PeerDataOperationRequestType != nil { + return *x.PeerDataOperationRequestType + } + return PeerDataOperationRequestType_UPLOAD_STICKER +} + +func (x *PeerDataOperationRequestResponseMessage) GetStanzaId() string { + if x != nil && x.StanzaId != nil { + return *x.StanzaId + } + return "" +} + +func (x *PeerDataOperationRequestResponseMessage) GetPeerDataOperationResult() []*PeerDataOperationRequestResponseMessage_PeerDataOperationResult { + if x != nil { + return x.PeerDataOperationResult + } + return nil +} + type EphemeralSetting struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -10986,7 +11456,7 @@ type EphemeralSetting struct { func (x *EphemeralSetting) Reset() { *x = EphemeralSetting{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[74] + mi := &file_binary_proto_def_proto_msgTypes[78] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -10999,7 +11469,7 @@ func (x *EphemeralSetting) String() string { func (*EphemeralSetting) ProtoMessage() {} func (x *EphemeralSetting) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[74] + mi := &file_binary_proto_def_proto_msgTypes[78] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11012,7 +11482,7 @@ func (x *EphemeralSetting) ProtoReflect() protoreflect.Message { // Deprecated: Use EphemeralSetting.ProtoReflect.Descriptor instead. func (*EphemeralSetting) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{74} + return file_binary_proto_def_proto_rawDescGZIP(), []int{78} } func (x *EphemeralSetting) GetDuration() int32 { @@ -11041,7 +11511,7 @@ type WallpaperSettings struct { func (x *WallpaperSettings) Reset() { *x = WallpaperSettings{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[75] + mi := &file_binary_proto_def_proto_msgTypes[79] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11054,7 +11524,7 @@ func (x *WallpaperSettings) String() string { func (*WallpaperSettings) ProtoMessage() {} func (x *WallpaperSettings) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[75] + mi := &file_binary_proto_def_proto_msgTypes[79] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11067,7 +11537,7 @@ func (x *WallpaperSettings) ProtoReflect() protoreflect.Message { // Deprecated: Use WallpaperSettings.ProtoReflect.Descriptor instead. func (*WallpaperSettings) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{75} + return file_binary_proto_def_proto_rawDescGZIP(), []int{79} } func (x *WallpaperSettings) GetFilename() string { @@ -11105,7 +11575,7 @@ type StickerMetadata struct { func (x *StickerMetadata) Reset() { *x = StickerMetadata{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[76] + mi := &file_binary_proto_def_proto_msgTypes[80] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11118,7 +11588,7 @@ func (x *StickerMetadata) String() string { func (*StickerMetadata) ProtoMessage() {} func (x *StickerMetadata) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[76] + mi := &file_binary_proto_def_proto_msgTypes[80] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11131,7 +11601,7 @@ func (x *StickerMetadata) ProtoReflect() protoreflect.Message { // Deprecated: Use StickerMetadata.ProtoReflect.Descriptor instead. func (*StickerMetadata) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{76} + return file_binary_proto_def_proto_rawDescGZIP(), []int{80} } func (x *StickerMetadata) GetUrl() string { @@ -11223,7 +11693,7 @@ type Pushname struct { func (x *Pushname) Reset() { *x = Pushname{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[77] + mi := &file_binary_proto_def_proto_msgTypes[81] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11236,7 +11706,7 @@ func (x *Pushname) String() string { func (*Pushname) ProtoMessage() {} func (x *Pushname) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[77] + mi := &file_binary_proto_def_proto_msgTypes[81] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11249,7 +11719,7 @@ func (x *Pushname) ProtoReflect() protoreflect.Message { // Deprecated: Use Pushname.ProtoReflect.Descriptor instead. func (*Pushname) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{77} + return file_binary_proto_def_proto_rawDescGZIP(), []int{81} } func (x *Pushname) GetId() string { @@ -11278,7 +11748,7 @@ type PastParticipants struct { func (x *PastParticipants) Reset() { *x = PastParticipants{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[78] + mi := &file_binary_proto_def_proto_msgTypes[82] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11291,7 +11761,7 @@ func (x *PastParticipants) String() string { func (*PastParticipants) ProtoMessage() {} func (x *PastParticipants) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[78] + mi := &file_binary_proto_def_proto_msgTypes[82] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11304,7 +11774,7 @@ func (x *PastParticipants) ProtoReflect() protoreflect.Message { // Deprecated: Use PastParticipants.ProtoReflect.Descriptor instead. func (*PastParticipants) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{78} + return file_binary_proto_def_proto_rawDescGZIP(), []int{82} } func (x *PastParticipants) GetGroupJid() string { @@ -11334,7 +11804,7 @@ type PastParticipant struct { func (x *PastParticipant) Reset() { *x = PastParticipant{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[79] + mi := &file_binary_proto_def_proto_msgTypes[83] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11347,7 +11817,7 @@ func (x *PastParticipant) String() string { func (*PastParticipant) ProtoMessage() {} func (x *PastParticipant) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[79] + mi := &file_binary_proto_def_proto_msgTypes[83] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11360,7 +11830,7 @@ func (x *PastParticipant) ProtoReflect() protoreflect.Message { // Deprecated: Use PastParticipant.ProtoReflect.Descriptor instead. func (*PastParticipant) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{79} + return file_binary_proto_def_proto_rawDescGZIP(), []int{83} } func (x *PastParticipant) GetUserJid() string { @@ -11405,7 +11875,7 @@ type HistorySync struct { func (x *HistorySync) Reset() { *x = HistorySync{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[80] + mi := &file_binary_proto_def_proto_msgTypes[84] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11418,7 +11888,7 @@ func (x *HistorySync) String() string { func (*HistorySync) ProtoMessage() {} func (x *HistorySync) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[80] + mi := &file_binary_proto_def_proto_msgTypes[84] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11431,7 +11901,7 @@ func (x *HistorySync) ProtoReflect() protoreflect.Message { // Deprecated: Use HistorySync.ProtoReflect.Descriptor instead. func (*HistorySync) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{80} + return file_binary_proto_def_proto_rawDescGZIP(), []int{84} } func (x *HistorySync) GetSyncType() HistorySync_HistorySyncType { @@ -11523,7 +11993,7 @@ type HistorySyncMsg struct { func (x *HistorySyncMsg) Reset() { *x = HistorySyncMsg{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[81] + mi := &file_binary_proto_def_proto_msgTypes[85] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11536,7 +12006,7 @@ func (x *HistorySyncMsg) String() string { func (*HistorySyncMsg) ProtoMessage() {} func (x *HistorySyncMsg) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[81] + mi := &file_binary_proto_def_proto_msgTypes[85] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11549,7 +12019,7 @@ func (x *HistorySyncMsg) ProtoReflect() protoreflect.Message { // Deprecated: Use HistorySyncMsg.ProtoReflect.Descriptor instead. func (*HistorySyncMsg) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{81} + return file_binary_proto_def_proto_rawDescGZIP(), []int{85} } func (x *HistorySyncMsg) GetMessage() *WebMessageInfo { @@ -11578,7 +12048,7 @@ type GroupParticipant struct { func (x *GroupParticipant) Reset() { *x = GroupParticipant{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[82] + mi := &file_binary_proto_def_proto_msgTypes[86] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11591,7 +12061,7 @@ func (x *GroupParticipant) String() string { func (*GroupParticipant) ProtoMessage() {} func (x *GroupParticipant) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[82] + mi := &file_binary_proto_def_proto_msgTypes[86] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11604,7 +12074,7 @@ func (x *GroupParticipant) ProtoReflect() protoreflect.Message { // Deprecated: Use GroupParticipant.ProtoReflect.Descriptor instead. func (*GroupParticipant) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{82} + return file_binary_proto_def_proto_rawDescGZIP(), []int{86} } func (x *GroupParticipant) GetUserJid() string { @@ -11642,7 +12112,7 @@ type GlobalSettings struct { func (x *GlobalSettings) Reset() { *x = GlobalSettings{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[83] + mi := &file_binary_proto_def_proto_msgTypes[87] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11655,7 +12125,7 @@ func (x *GlobalSettings) String() string { func (*GlobalSettings) ProtoMessage() {} func (x *GlobalSettings) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[83] + mi := &file_binary_proto_def_proto_msgTypes[87] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11668,7 +12138,7 @@ func (x *GlobalSettings) ProtoReflect() protoreflect.Message { // Deprecated: Use GlobalSettings.ProtoReflect.Descriptor instead. func (*GlobalSettings) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{83} + return file_binary_proto_def_proto_rawDescGZIP(), []int{87} } func (x *GlobalSettings) GetLightThemeWallpaper() *WallpaperSettings { @@ -11788,8 +12258,8 @@ type Conversation struct { Description *string `protobuf:"bytes,33,opt,name=description" json:"description,omitempty"` Support *bool `protobuf:"varint,34,opt,name=support" json:"support,omitempty"` IsParentGroup *bool `protobuf:"varint,35,opt,name=isParentGroup" json:"isParentGroup,omitempty"` - IsDefaultSubgroup *bool `protobuf:"varint,36,opt,name=isDefaultSubgroup" json:"isDefaultSubgroup,omitempty"` ParentGroupId *string `protobuf:"bytes,37,opt,name=parentGroupId" json:"parentGroupId,omitempty"` + IsDefaultSubgroup *bool `protobuf:"varint,36,opt,name=isDefaultSubgroup" json:"isDefaultSubgroup,omitempty"` DisplayName *string `protobuf:"bytes,38,opt,name=displayName" json:"displayName,omitempty"` PnJid *string `protobuf:"bytes,39,opt,name=pnJid" json:"pnJid,omitempty"` ShareOwnPn *bool `protobuf:"varint,40,opt,name=shareOwnPn" json:"shareOwnPn,omitempty"` @@ -11800,7 +12270,7 @@ type Conversation struct { func (x *Conversation) Reset() { *x = Conversation{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[84] + mi := &file_binary_proto_def_proto_msgTypes[88] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -11813,7 +12283,7 @@ func (x *Conversation) String() string { func (*Conversation) ProtoMessage() {} func (x *Conversation) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[84] + mi := &file_binary_proto_def_proto_msgTypes[88] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -11826,7 +12296,7 @@ func (x *Conversation) ProtoReflect() protoreflect.Message { // Deprecated: Use Conversation.ProtoReflect.Descriptor instead. func (*Conversation) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{84} + return file_binary_proto_def_proto_rawDescGZIP(), []int{88} } func (x *Conversation) GetId() string { @@ -12074,13 +12544,6 @@ func (x *Conversation) GetIsParentGroup() bool { return false } -func (x *Conversation) GetIsDefaultSubgroup() bool { - if x != nil && x.IsDefaultSubgroup != nil { - return *x.IsDefaultSubgroup - } - return false -} - func (x *Conversation) GetParentGroupId() string { if x != nil && x.ParentGroupId != nil { return *x.ParentGroupId @@ -12088,6 +12551,13 @@ func (x *Conversation) GetParentGroupId() string { return "" } +func (x *Conversation) GetIsDefaultSubgroup() bool { + if x != nil && x.IsDefaultSubgroup != nil { + return *x.IsDefaultSubgroup + } + return false +} + func (x *Conversation) GetDisplayName() string { if x != nil && x.DisplayName != nil { return *x.DisplayName @@ -12135,7 +12605,7 @@ type AvatarUserSettings struct { func (x *AvatarUserSettings) Reset() { *x = AvatarUserSettings{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[85] + mi := &file_binary_proto_def_proto_msgTypes[89] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12148,7 +12618,7 @@ func (x *AvatarUserSettings) String() string { func (*AvatarUserSettings) ProtoMessage() {} func (x *AvatarUserSettings) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[85] + mi := &file_binary_proto_def_proto_msgTypes[89] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12161,7 +12631,7 @@ func (x *AvatarUserSettings) ProtoReflect() protoreflect.Message { // Deprecated: Use AvatarUserSettings.ProtoReflect.Descriptor instead. func (*AvatarUserSettings) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{85} + return file_binary_proto_def_proto_rawDescGZIP(), []int{89} } func (x *AvatarUserSettings) GetFbid() string { @@ -12192,7 +12662,7 @@ type AutoDownloadSettings struct { func (x *AutoDownloadSettings) Reset() { *x = AutoDownloadSettings{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[86] + mi := &file_binary_proto_def_proto_msgTypes[90] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12205,7 +12675,7 @@ func (x *AutoDownloadSettings) String() string { func (*AutoDownloadSettings) ProtoMessage() {} func (x *AutoDownloadSettings) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[86] + mi := &file_binary_proto_def_proto_msgTypes[90] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12218,7 +12688,7 @@ func (x *AutoDownloadSettings) ProtoReflect() protoreflect.Message { // Deprecated: Use AutoDownloadSettings.ProtoReflect.Descriptor instead. func (*AutoDownloadSettings) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{86} + return file_binary_proto_def_proto_rawDescGZIP(), []int{90} } func (x *AutoDownloadSettings) GetDownloadImages() bool { @@ -12261,7 +12731,7 @@ type MsgRowOpaqueData struct { func (x *MsgRowOpaqueData) Reset() { *x = MsgRowOpaqueData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[87] + mi := &file_binary_proto_def_proto_msgTypes[91] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12274,7 +12744,7 @@ func (x *MsgRowOpaqueData) String() string { func (*MsgRowOpaqueData) ProtoMessage() {} func (x *MsgRowOpaqueData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[87] + mi := &file_binary_proto_def_proto_msgTypes[91] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12287,7 +12757,7 @@ func (x *MsgRowOpaqueData) ProtoReflect() protoreflect.Message { // Deprecated: Use MsgRowOpaqueData.ProtoReflect.Descriptor instead. func (*MsgRowOpaqueData) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{87} + return file_binary_proto_def_proto_rawDescGZIP(), []int{91} } func (x *MsgRowOpaqueData) GetCurrentMsg() *MsgOpaqueData { @@ -12340,7 +12810,7 @@ type MsgOpaqueData struct { func (x *MsgOpaqueData) Reset() { *x = MsgOpaqueData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[88] + mi := &file_binary_proto_def_proto_msgTypes[92] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12353,7 +12823,7 @@ func (x *MsgOpaqueData) String() string { func (*MsgOpaqueData) ProtoMessage() {} func (x *MsgOpaqueData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[88] + mi := &file_binary_proto_def_proto_msgTypes[92] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12366,7 +12836,7 @@ func (x *MsgOpaqueData) ProtoReflect() protoreflect.Message { // Deprecated: Use MsgOpaqueData.ProtoReflect.Descriptor instead. func (*MsgOpaqueData) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{88} + return file_binary_proto_def_proto_rawDescGZIP(), []int{92} } func (x *MsgOpaqueData) GetBody() string { @@ -12562,7 +13032,7 @@ type ServerErrorReceipt struct { func (x *ServerErrorReceipt) Reset() { *x = ServerErrorReceipt{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[89] + mi := &file_binary_proto_def_proto_msgTypes[93] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12575,7 +13045,7 @@ func (x *ServerErrorReceipt) String() string { func (*ServerErrorReceipt) ProtoMessage() {} func (x *ServerErrorReceipt) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[89] + mi := &file_binary_proto_def_proto_msgTypes[93] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12588,7 +13058,7 @@ func (x *ServerErrorReceipt) ProtoReflect() protoreflect.Message { // Deprecated: Use ServerErrorReceipt.ProtoReflect.Descriptor instead. func (*ServerErrorReceipt) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{89} + return file_binary_proto_def_proto_rawDescGZIP(), []int{93} } func (x *ServerErrorReceipt) GetStanzaId() string { @@ -12611,7 +13081,7 @@ type MediaRetryNotification struct { func (x *MediaRetryNotification) Reset() { *x = MediaRetryNotification{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[90] + mi := &file_binary_proto_def_proto_msgTypes[94] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12624,7 +13094,7 @@ func (x *MediaRetryNotification) String() string { func (*MediaRetryNotification) ProtoMessage() {} func (x *MediaRetryNotification) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[90] + mi := &file_binary_proto_def_proto_msgTypes[94] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12637,7 +13107,7 @@ func (x *MediaRetryNotification) ProtoReflect() protoreflect.Message { // Deprecated: Use MediaRetryNotification.ProtoReflect.Descriptor instead. func (*MediaRetryNotification) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{90} + return file_binary_proto_def_proto_rawDescGZIP(), []int{94} } func (x *MediaRetryNotification) GetStanzaId() string { @@ -12675,7 +13145,7 @@ type MessageKey struct { func (x *MessageKey) Reset() { *x = MessageKey{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[91] + mi := &file_binary_proto_def_proto_msgTypes[95] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12688,7 +13158,7 @@ func (x *MessageKey) String() string { func (*MessageKey) ProtoMessage() {} func (x *MessageKey) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[91] + mi := &file_binary_proto_def_proto_msgTypes[95] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12701,7 +13171,7 @@ func (x *MessageKey) ProtoReflect() protoreflect.Message { // Deprecated: Use MessageKey.ProtoReflect.Descriptor instead. func (*MessageKey) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{91} + return file_binary_proto_def_proto_rawDescGZIP(), []int{95} } func (x *MessageKey) GetRemoteJid() string { @@ -12743,7 +13213,7 @@ type SyncdVersion struct { func (x *SyncdVersion) Reset() { *x = SyncdVersion{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[92] + mi := &file_binary_proto_def_proto_msgTypes[96] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12756,7 +13226,7 @@ func (x *SyncdVersion) String() string { func (*SyncdVersion) ProtoMessage() {} func (x *SyncdVersion) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[92] + mi := &file_binary_proto_def_proto_msgTypes[96] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12769,7 +13239,7 @@ func (x *SyncdVersion) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdVersion.ProtoReflect.Descriptor instead. func (*SyncdVersion) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{92} + return file_binary_proto_def_proto_rawDescGZIP(), []int{96} } func (x *SyncdVersion) GetVersion() uint64 { @@ -12790,7 +13260,7 @@ type SyncdValue struct { func (x *SyncdValue) Reset() { *x = SyncdValue{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[93] + mi := &file_binary_proto_def_proto_msgTypes[97] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12803,7 +13273,7 @@ func (x *SyncdValue) String() string { func (*SyncdValue) ProtoMessage() {} func (x *SyncdValue) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[93] + mi := &file_binary_proto_def_proto_msgTypes[97] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12816,7 +13286,7 @@ func (x *SyncdValue) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdValue.ProtoReflect.Descriptor instead. func (*SyncdValue) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{93} + return file_binary_proto_def_proto_rawDescGZIP(), []int{97} } func (x *SyncdValue) GetBlob() []byte { @@ -12840,7 +13310,7 @@ type SyncdSnapshot struct { func (x *SyncdSnapshot) Reset() { *x = SyncdSnapshot{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[94] + mi := &file_binary_proto_def_proto_msgTypes[98] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12853,7 +13323,7 @@ func (x *SyncdSnapshot) String() string { func (*SyncdSnapshot) ProtoMessage() {} func (x *SyncdSnapshot) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[94] + mi := &file_binary_proto_def_proto_msgTypes[98] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12866,7 +13336,7 @@ func (x *SyncdSnapshot) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdSnapshot.ProtoReflect.Descriptor instead. func (*SyncdSnapshot) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{94} + return file_binary_proto_def_proto_rawDescGZIP(), []int{98} } func (x *SyncdSnapshot) GetVersion() *SyncdVersion { @@ -12910,7 +13380,7 @@ type SyncdRecord struct { func (x *SyncdRecord) Reset() { *x = SyncdRecord{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[95] + mi := &file_binary_proto_def_proto_msgTypes[99] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12923,7 +13393,7 @@ func (x *SyncdRecord) String() string { func (*SyncdRecord) ProtoMessage() {} func (x *SyncdRecord) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[95] + mi := &file_binary_proto_def_proto_msgTypes[99] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -12936,7 +13406,7 @@ func (x *SyncdRecord) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdRecord.ProtoReflect.Descriptor instead. func (*SyncdRecord) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{95} + return file_binary_proto_def_proto_rawDescGZIP(), []int{99} } func (x *SyncdRecord) GetIndex() *SyncdIndex { @@ -12978,7 +13448,7 @@ type SyncdPatch struct { func (x *SyncdPatch) Reset() { *x = SyncdPatch{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[96] + mi := &file_binary_proto_def_proto_msgTypes[100] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -12991,7 +13461,7 @@ func (x *SyncdPatch) String() string { func (*SyncdPatch) ProtoMessage() {} func (x *SyncdPatch) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[96] + mi := &file_binary_proto_def_proto_msgTypes[100] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13004,7 +13474,7 @@ func (x *SyncdPatch) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdPatch.ProtoReflect.Descriptor instead. func (*SyncdPatch) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{96} + return file_binary_proto_def_proto_rawDescGZIP(), []int{100} } func (x *SyncdPatch) GetVersion() *SyncdVersion { @@ -13074,7 +13544,7 @@ type SyncdMutations struct { func (x *SyncdMutations) Reset() { *x = SyncdMutations{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[97] + mi := &file_binary_proto_def_proto_msgTypes[101] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13087,7 +13557,7 @@ func (x *SyncdMutations) String() string { func (*SyncdMutations) ProtoMessage() {} func (x *SyncdMutations) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[97] + mi := &file_binary_proto_def_proto_msgTypes[101] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13100,7 +13570,7 @@ func (x *SyncdMutations) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdMutations.ProtoReflect.Descriptor instead. func (*SyncdMutations) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{97} + return file_binary_proto_def_proto_rawDescGZIP(), []int{101} } func (x *SyncdMutations) GetMutations() []*SyncdMutation { @@ -13122,7 +13592,7 @@ type SyncdMutation struct { func (x *SyncdMutation) Reset() { *x = SyncdMutation{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[98] + mi := &file_binary_proto_def_proto_msgTypes[102] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13135,7 +13605,7 @@ func (x *SyncdMutation) String() string { func (*SyncdMutation) ProtoMessage() {} func (x *SyncdMutation) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[98] + mi := &file_binary_proto_def_proto_msgTypes[102] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13148,7 +13618,7 @@ func (x *SyncdMutation) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdMutation.ProtoReflect.Descriptor instead. func (*SyncdMutation) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{98} + return file_binary_proto_def_proto_rawDescGZIP(), []int{102} } func (x *SyncdMutation) GetOperation() SyncdMutation_SyncdOperation { @@ -13176,7 +13646,7 @@ type SyncdIndex struct { func (x *SyncdIndex) Reset() { *x = SyncdIndex{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[99] + mi := &file_binary_proto_def_proto_msgTypes[103] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13189,7 +13659,7 @@ func (x *SyncdIndex) String() string { func (*SyncdIndex) ProtoMessage() {} func (x *SyncdIndex) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[99] + mi := &file_binary_proto_def_proto_msgTypes[103] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13202,7 +13672,7 @@ func (x *SyncdIndex) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncdIndex.ProtoReflect.Descriptor instead. func (*SyncdIndex) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{99} + return file_binary_proto_def_proto_rawDescGZIP(), []int{103} } func (x *SyncdIndex) GetBlob() []byte { @@ -13223,7 +13693,7 @@ type KeyId struct { func (x *KeyId) Reset() { *x = KeyId{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[100] + mi := &file_binary_proto_def_proto_msgTypes[104] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13236,7 +13706,7 @@ func (x *KeyId) String() string { func (*KeyId) ProtoMessage() {} func (x *KeyId) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[100] + mi := &file_binary_proto_def_proto_msgTypes[104] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13249,7 +13719,7 @@ func (x *KeyId) ProtoReflect() protoreflect.Message { // Deprecated: Use KeyId.ProtoReflect.Descriptor instead. func (*KeyId) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{100} + return file_binary_proto_def_proto_rawDescGZIP(), []int{104} } func (x *KeyId) GetId() []byte { @@ -13275,7 +13745,7 @@ type ExternalBlobReference struct { func (x *ExternalBlobReference) Reset() { *x = ExternalBlobReference{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[101] + mi := &file_binary_proto_def_proto_msgTypes[105] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13288,7 +13758,7 @@ func (x *ExternalBlobReference) String() string { func (*ExternalBlobReference) ProtoMessage() {} func (x *ExternalBlobReference) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[101] + mi := &file_binary_proto_def_proto_msgTypes[105] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13301,7 +13771,7 @@ func (x *ExternalBlobReference) ProtoReflect() protoreflect.Message { // Deprecated: Use ExternalBlobReference.ProtoReflect.Descriptor instead. func (*ExternalBlobReference) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{101} + return file_binary_proto_def_proto_rawDescGZIP(), []int{105} } func (x *ExternalBlobReference) GetMediaKey() []byte { @@ -13358,7 +13828,7 @@ type ExitCode struct { func (x *ExitCode) Reset() { *x = ExitCode{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[102] + mi := &file_binary_proto_def_proto_msgTypes[106] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13371,7 +13841,7 @@ func (x *ExitCode) String() string { func (*ExitCode) ProtoMessage() {} func (x *ExitCode) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[102] + mi := &file_binary_proto_def_proto_msgTypes[106] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13384,7 +13854,7 @@ func (x *ExitCode) ProtoReflect() protoreflect.Message { // Deprecated: Use ExitCode.ProtoReflect.Descriptor instead. func (*ExitCode) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{102} + return file_binary_proto_def_proto_rawDescGZIP(), []int{106} } func (x *ExitCode) GetCode() uint64 { @@ -13443,7 +13913,7 @@ type SyncActionValue struct { func (x *SyncActionValue) Reset() { *x = SyncActionValue{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[103] + mi := &file_binary_proto_def_proto_msgTypes[107] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13456,7 +13926,7 @@ func (x *SyncActionValue) String() string { func (*SyncActionValue) ProtoMessage() {} func (x *SyncActionValue) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[103] + mi := &file_binary_proto_def_proto_msgTypes[107] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13469,7 +13939,7 @@ func (x *SyncActionValue) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncActionValue.ProtoReflect.Descriptor instead. func (*SyncActionValue) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{103} + return file_binary_proto_def_proto_rawDescGZIP(), []int{107} } func (x *SyncActionValue) GetTimestamp() int64 { @@ -13707,7 +14177,7 @@ type UserStatusMuteAction struct { func (x *UserStatusMuteAction) Reset() { *x = UserStatusMuteAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[104] + mi := &file_binary_proto_def_proto_msgTypes[108] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13720,7 +14190,7 @@ func (x *UserStatusMuteAction) String() string { func (*UserStatusMuteAction) ProtoMessage() {} func (x *UserStatusMuteAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[104] + mi := &file_binary_proto_def_proto_msgTypes[108] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13733,7 +14203,7 @@ func (x *UserStatusMuteAction) ProtoReflect() protoreflect.Message { // Deprecated: Use UserStatusMuteAction.ProtoReflect.Descriptor instead. func (*UserStatusMuteAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{104} + return file_binary_proto_def_proto_rawDescGZIP(), []int{108} } func (x *UserStatusMuteAction) GetMuted() bool { @@ -13754,7 +14224,7 @@ type UnarchiveChatsSetting struct { func (x *UnarchiveChatsSetting) Reset() { *x = UnarchiveChatsSetting{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[105] + mi := &file_binary_proto_def_proto_msgTypes[109] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13767,7 +14237,7 @@ func (x *UnarchiveChatsSetting) String() string { func (*UnarchiveChatsSetting) ProtoMessage() {} func (x *UnarchiveChatsSetting) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[105] + mi := &file_binary_proto_def_proto_msgTypes[109] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13780,7 +14250,7 @@ func (x *UnarchiveChatsSetting) ProtoReflect() protoreflect.Message { // Deprecated: Use UnarchiveChatsSetting.ProtoReflect.Descriptor instead. func (*UnarchiveChatsSetting) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{105} + return file_binary_proto_def_proto_rawDescGZIP(), []int{109} } func (x *UnarchiveChatsSetting) GetUnarchiveChats() bool { @@ -13801,7 +14271,7 @@ type TimeFormatAction struct { func (x *TimeFormatAction) Reset() { *x = TimeFormatAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[106] + mi := &file_binary_proto_def_proto_msgTypes[110] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13814,7 +14284,7 @@ func (x *TimeFormatAction) String() string { func (*TimeFormatAction) ProtoMessage() {} func (x *TimeFormatAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[106] + mi := &file_binary_proto_def_proto_msgTypes[110] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13827,7 +14297,7 @@ func (x *TimeFormatAction) ProtoReflect() protoreflect.Message { // Deprecated: Use TimeFormatAction.ProtoReflect.Descriptor instead. func (*TimeFormatAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{106} + return file_binary_proto_def_proto_rawDescGZIP(), []int{110} } func (x *TimeFormatAction) GetIsTwentyFourHourFormatEnabled() bool { @@ -13849,7 +14319,7 @@ type SyncActionMessage struct { func (x *SyncActionMessage) Reset() { *x = SyncActionMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[107] + mi := &file_binary_proto_def_proto_msgTypes[111] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13862,7 +14332,7 @@ func (x *SyncActionMessage) String() string { func (*SyncActionMessage) ProtoMessage() {} func (x *SyncActionMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[107] + mi := &file_binary_proto_def_proto_msgTypes[111] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13875,7 +14345,7 @@ func (x *SyncActionMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncActionMessage.ProtoReflect.Descriptor instead. func (*SyncActionMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{107} + return file_binary_proto_def_proto_rawDescGZIP(), []int{111} } func (x *SyncActionMessage) GetKey() *MessageKey { @@ -13905,7 +14375,7 @@ type SyncActionMessageRange struct { func (x *SyncActionMessageRange) Reset() { *x = SyncActionMessageRange{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[108] + mi := &file_binary_proto_def_proto_msgTypes[112] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13918,7 +14388,7 @@ func (x *SyncActionMessageRange) String() string { func (*SyncActionMessageRange) ProtoMessage() {} func (x *SyncActionMessageRange) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[108] + mi := &file_binary_proto_def_proto_msgTypes[112] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13931,7 +14401,7 @@ func (x *SyncActionMessageRange) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncActionMessageRange.ProtoReflect.Descriptor instead. func (*SyncActionMessageRange) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{108} + return file_binary_proto_def_proto_rawDescGZIP(), []int{112} } func (x *SyncActionMessageRange) GetLastMessageTimestamp() int64 { @@ -13968,7 +14438,7 @@ type SubscriptionAction struct { func (x *SubscriptionAction) Reset() { *x = SubscriptionAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[109] + mi := &file_binary_proto_def_proto_msgTypes[113] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -13981,7 +14451,7 @@ func (x *SubscriptionAction) String() string { func (*SubscriptionAction) ProtoMessage() {} func (x *SubscriptionAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[109] + mi := &file_binary_proto_def_proto_msgTypes[113] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -13994,7 +14464,7 @@ func (x *SubscriptionAction) ProtoReflect() protoreflect.Message { // Deprecated: Use SubscriptionAction.ProtoReflect.Descriptor instead. func (*SubscriptionAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{109} + return file_binary_proto_def_proto_rawDescGZIP(), []int{113} } func (x *SubscriptionAction) GetIsDeactivated() bool { @@ -14038,7 +14508,7 @@ type StickerAction struct { func (x *StickerAction) Reset() { *x = StickerAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[110] + mi := &file_binary_proto_def_proto_msgTypes[114] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14051,7 +14521,7 @@ func (x *StickerAction) String() string { func (*StickerAction) ProtoMessage() {} func (x *StickerAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[110] + mi := &file_binary_proto_def_proto_msgTypes[114] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14064,7 +14534,7 @@ func (x *StickerAction) ProtoReflect() protoreflect.Message { // Deprecated: Use StickerAction.ProtoReflect.Descriptor instead. func (*StickerAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{110} + return file_binary_proto_def_proto_rawDescGZIP(), []int{114} } func (x *StickerAction) GetUrl() string { @@ -14148,7 +14618,7 @@ type StarAction struct { func (x *StarAction) Reset() { *x = StarAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[111] + mi := &file_binary_proto_def_proto_msgTypes[115] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14161,7 +14631,7 @@ func (x *StarAction) String() string { func (*StarAction) ProtoMessage() {} func (x *StarAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[111] + mi := &file_binary_proto_def_proto_msgTypes[115] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14174,7 +14644,7 @@ func (x *StarAction) ProtoReflect() protoreflect.Message { // Deprecated: Use StarAction.ProtoReflect.Descriptor instead. func (*StarAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{111} + return file_binary_proto_def_proto_rawDescGZIP(), []int{115} } func (x *StarAction) GetStarred() bool { @@ -14195,7 +14665,7 @@ type SecurityNotificationSetting struct { func (x *SecurityNotificationSetting) Reset() { *x = SecurityNotificationSetting{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[112] + mi := &file_binary_proto_def_proto_msgTypes[116] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14208,7 +14678,7 @@ func (x *SecurityNotificationSetting) String() string { func (*SecurityNotificationSetting) ProtoMessage() {} func (x *SecurityNotificationSetting) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[112] + mi := &file_binary_proto_def_proto_msgTypes[116] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14221,7 +14691,7 @@ func (x *SecurityNotificationSetting) ProtoReflect() protoreflect.Message { // Deprecated: Use SecurityNotificationSetting.ProtoReflect.Descriptor instead. func (*SecurityNotificationSetting) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{112} + return file_binary_proto_def_proto_rawDescGZIP(), []int{116} } func (x *SecurityNotificationSetting) GetShowNotification() bool { @@ -14242,7 +14712,7 @@ type RemoveRecentStickerAction struct { func (x *RemoveRecentStickerAction) Reset() { *x = RemoveRecentStickerAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[113] + mi := &file_binary_proto_def_proto_msgTypes[117] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14255,7 +14725,7 @@ func (x *RemoveRecentStickerAction) String() string { func (*RemoveRecentStickerAction) ProtoMessage() {} func (x *RemoveRecentStickerAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[113] + mi := &file_binary_proto_def_proto_msgTypes[117] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14268,7 +14738,7 @@ func (x *RemoveRecentStickerAction) ProtoReflect() protoreflect.Message { // Deprecated: Use RemoveRecentStickerAction.ProtoReflect.Descriptor instead. func (*RemoveRecentStickerAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{113} + return file_binary_proto_def_proto_rawDescGZIP(), []int{117} } func (x *RemoveRecentStickerAction) GetLastStickerSentTs() int64 { @@ -14289,7 +14759,7 @@ type RecentEmojiWeightsAction struct { func (x *RecentEmojiWeightsAction) Reset() { *x = RecentEmojiWeightsAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[114] + mi := &file_binary_proto_def_proto_msgTypes[118] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14302,7 +14772,7 @@ func (x *RecentEmojiWeightsAction) String() string { func (*RecentEmojiWeightsAction) ProtoMessage() {} func (x *RecentEmojiWeightsAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[114] + mi := &file_binary_proto_def_proto_msgTypes[118] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14315,7 +14785,7 @@ func (x *RecentEmojiWeightsAction) ProtoReflect() protoreflect.Message { // Deprecated: Use RecentEmojiWeightsAction.ProtoReflect.Descriptor instead. func (*RecentEmojiWeightsAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{114} + return file_binary_proto_def_proto_rawDescGZIP(), []int{118} } func (x *RecentEmojiWeightsAction) GetWeights() []*RecentEmojiWeight { @@ -14340,7 +14810,7 @@ type QuickReplyAction struct { func (x *QuickReplyAction) Reset() { *x = QuickReplyAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[115] + mi := &file_binary_proto_def_proto_msgTypes[119] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14353,7 +14823,7 @@ func (x *QuickReplyAction) String() string { func (*QuickReplyAction) ProtoMessage() {} func (x *QuickReplyAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[115] + mi := &file_binary_proto_def_proto_msgTypes[119] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14366,7 +14836,7 @@ func (x *QuickReplyAction) ProtoReflect() protoreflect.Message { // Deprecated: Use QuickReplyAction.ProtoReflect.Descriptor instead. func (*QuickReplyAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{115} + return file_binary_proto_def_proto_rawDescGZIP(), []int{119} } func (x *QuickReplyAction) GetShortcut() string { @@ -14415,7 +14885,7 @@ type PushNameSetting struct { func (x *PushNameSetting) Reset() { *x = PushNameSetting{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[116] + mi := &file_binary_proto_def_proto_msgTypes[120] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14428,7 +14898,7 @@ func (x *PushNameSetting) String() string { func (*PushNameSetting) ProtoMessage() {} func (x *PushNameSetting) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[116] + mi := &file_binary_proto_def_proto_msgTypes[120] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14441,7 +14911,7 @@ func (x *PushNameSetting) ProtoReflect() protoreflect.Message { // Deprecated: Use PushNameSetting.ProtoReflect.Descriptor instead. func (*PushNameSetting) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{116} + return file_binary_proto_def_proto_rawDescGZIP(), []int{120} } func (x *PushNameSetting) GetName() string { @@ -14462,7 +14932,7 @@ type PrimaryVersionAction struct { func (x *PrimaryVersionAction) Reset() { *x = PrimaryVersionAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[117] + mi := &file_binary_proto_def_proto_msgTypes[121] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14475,7 +14945,7 @@ func (x *PrimaryVersionAction) String() string { func (*PrimaryVersionAction) ProtoMessage() {} func (x *PrimaryVersionAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[117] + mi := &file_binary_proto_def_proto_msgTypes[121] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14488,7 +14958,7 @@ func (x *PrimaryVersionAction) ProtoReflect() protoreflect.Message { // Deprecated: Use PrimaryVersionAction.ProtoReflect.Descriptor instead. func (*PrimaryVersionAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{117} + return file_binary_proto_def_proto_rawDescGZIP(), []int{121} } func (x *PrimaryVersionAction) GetVersion() string { @@ -14509,7 +14979,7 @@ type PrimaryFeature struct { func (x *PrimaryFeature) Reset() { *x = PrimaryFeature{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[118] + mi := &file_binary_proto_def_proto_msgTypes[122] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14522,7 +14992,7 @@ func (x *PrimaryFeature) String() string { func (*PrimaryFeature) ProtoMessage() {} func (x *PrimaryFeature) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[118] + mi := &file_binary_proto_def_proto_msgTypes[122] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14535,7 +15005,7 @@ func (x *PrimaryFeature) ProtoReflect() protoreflect.Message { // Deprecated: Use PrimaryFeature.ProtoReflect.Descriptor instead. func (*PrimaryFeature) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{118} + return file_binary_proto_def_proto_rawDescGZIP(), []int{122} } func (x *PrimaryFeature) GetFlags() []string { @@ -14556,7 +15026,7 @@ type PnForLidChatAction struct { func (x *PnForLidChatAction) Reset() { *x = PnForLidChatAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[119] + mi := &file_binary_proto_def_proto_msgTypes[123] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14569,7 +15039,7 @@ func (x *PnForLidChatAction) String() string { func (*PnForLidChatAction) ProtoMessage() {} func (x *PnForLidChatAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[119] + mi := &file_binary_proto_def_proto_msgTypes[123] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14582,7 +15052,7 @@ func (x *PnForLidChatAction) ProtoReflect() protoreflect.Message { // Deprecated: Use PnForLidChatAction.ProtoReflect.Descriptor instead. func (*PnForLidChatAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{119} + return file_binary_proto_def_proto_rawDescGZIP(), []int{123} } func (x *PnForLidChatAction) GetPnJid() string { @@ -14603,7 +15073,7 @@ type PinAction struct { func (x *PinAction) Reset() { *x = PinAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[120] + mi := &file_binary_proto_def_proto_msgTypes[124] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14616,7 +15086,7 @@ func (x *PinAction) String() string { func (*PinAction) ProtoMessage() {} func (x *PinAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[120] + mi := &file_binary_proto_def_proto_msgTypes[124] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14629,7 +15099,7 @@ func (x *PinAction) ProtoReflect() protoreflect.Message { // Deprecated: Use PinAction.ProtoReflect.Descriptor instead. func (*PinAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{120} + return file_binary_proto_def_proto_rawDescGZIP(), []int{124} } func (x *PinAction) GetPinned() bool { @@ -14650,7 +15120,7 @@ type NuxAction struct { func (x *NuxAction) Reset() { *x = NuxAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[121] + mi := &file_binary_proto_def_proto_msgTypes[125] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14663,7 +15133,7 @@ func (x *NuxAction) String() string { func (*NuxAction) ProtoMessage() {} func (x *NuxAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[121] + mi := &file_binary_proto_def_proto_msgTypes[125] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14676,7 +15146,7 @@ func (x *NuxAction) ProtoReflect() protoreflect.Message { // Deprecated: Use NuxAction.ProtoReflect.Descriptor instead. func (*NuxAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{121} + return file_binary_proto_def_proto_rawDescGZIP(), []int{125} } func (x *NuxAction) GetAcknowledged() bool { @@ -14699,7 +15169,7 @@ type MuteAction struct { func (x *MuteAction) Reset() { *x = MuteAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[122] + mi := &file_binary_proto_def_proto_msgTypes[126] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14712,7 +15182,7 @@ func (x *MuteAction) String() string { func (*MuteAction) ProtoMessage() {} func (x *MuteAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[122] + mi := &file_binary_proto_def_proto_msgTypes[126] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14725,7 +15195,7 @@ func (x *MuteAction) ProtoReflect() protoreflect.Message { // Deprecated: Use MuteAction.ProtoReflect.Descriptor instead. func (*MuteAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{122} + return file_binary_proto_def_proto_rawDescGZIP(), []int{126} } func (x *MuteAction) GetMuted() bool { @@ -14761,7 +15231,7 @@ type MarkChatAsReadAction struct { func (x *MarkChatAsReadAction) Reset() { *x = MarkChatAsReadAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[123] + mi := &file_binary_proto_def_proto_msgTypes[127] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14774,7 +15244,7 @@ func (x *MarkChatAsReadAction) String() string { func (*MarkChatAsReadAction) ProtoMessage() {} func (x *MarkChatAsReadAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[123] + mi := &file_binary_proto_def_proto_msgTypes[127] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14787,7 +15257,7 @@ func (x *MarkChatAsReadAction) ProtoReflect() protoreflect.Message { // Deprecated: Use MarkChatAsReadAction.ProtoReflect.Descriptor instead. func (*MarkChatAsReadAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{123} + return file_binary_proto_def_proto_rawDescGZIP(), []int{127} } func (x *MarkChatAsReadAction) GetRead() bool { @@ -14815,7 +15285,7 @@ type LocaleSetting struct { func (x *LocaleSetting) Reset() { *x = LocaleSetting{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[124] + mi := &file_binary_proto_def_proto_msgTypes[128] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14828,7 +15298,7 @@ func (x *LocaleSetting) String() string { func (*LocaleSetting) ProtoMessage() {} func (x *LocaleSetting) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[124] + mi := &file_binary_proto_def_proto_msgTypes[128] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14841,7 +15311,7 @@ func (x *LocaleSetting) ProtoReflect() protoreflect.Message { // Deprecated: Use LocaleSetting.ProtoReflect.Descriptor instead. func (*LocaleSetting) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{124} + return file_binary_proto_def_proto_rawDescGZIP(), []int{128} } func (x *LocaleSetting) GetLocale() string { @@ -14865,7 +15335,7 @@ type LabelEditAction struct { func (x *LabelEditAction) Reset() { *x = LabelEditAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[125] + mi := &file_binary_proto_def_proto_msgTypes[129] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14878,7 +15348,7 @@ func (x *LabelEditAction) String() string { func (*LabelEditAction) ProtoMessage() {} func (x *LabelEditAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[125] + mi := &file_binary_proto_def_proto_msgTypes[129] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14891,7 +15361,7 @@ func (x *LabelEditAction) ProtoReflect() protoreflect.Message { // Deprecated: Use LabelEditAction.ProtoReflect.Descriptor instead. func (*LabelEditAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{125} + return file_binary_proto_def_proto_rawDescGZIP(), []int{129} } func (x *LabelEditAction) GetName() string { @@ -14933,7 +15403,7 @@ type LabelAssociationAction struct { func (x *LabelAssociationAction) Reset() { *x = LabelAssociationAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[126] + mi := &file_binary_proto_def_proto_msgTypes[130] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14946,7 +15416,7 @@ func (x *LabelAssociationAction) String() string { func (*LabelAssociationAction) ProtoMessage() {} func (x *LabelAssociationAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[126] + mi := &file_binary_proto_def_proto_msgTypes[130] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -14959,7 +15429,7 @@ func (x *LabelAssociationAction) ProtoReflect() protoreflect.Message { // Deprecated: Use LabelAssociationAction.ProtoReflect.Descriptor instead. func (*LabelAssociationAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{126} + return file_binary_proto_def_proto_rawDescGZIP(), []int{130} } func (x *LabelAssociationAction) GetLabeled() bool { @@ -14980,7 +15450,7 @@ type KeyExpiration struct { func (x *KeyExpiration) Reset() { *x = KeyExpiration{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[127] + mi := &file_binary_proto_def_proto_msgTypes[131] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -14993,7 +15463,7 @@ func (x *KeyExpiration) String() string { func (*KeyExpiration) ProtoMessage() {} func (x *KeyExpiration) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[127] + mi := &file_binary_proto_def_proto_msgTypes[131] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15006,7 +15476,7 @@ func (x *KeyExpiration) ProtoReflect() protoreflect.Message { // Deprecated: Use KeyExpiration.ProtoReflect.Descriptor instead. func (*KeyExpiration) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{127} + return file_binary_proto_def_proto_rawDescGZIP(), []int{131} } func (x *KeyExpiration) GetExpiredKeyEpoch() int32 { @@ -15028,7 +15498,7 @@ type DeleteMessageForMeAction struct { func (x *DeleteMessageForMeAction) Reset() { *x = DeleteMessageForMeAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[128] + mi := &file_binary_proto_def_proto_msgTypes[132] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15041,7 +15511,7 @@ func (x *DeleteMessageForMeAction) String() string { func (*DeleteMessageForMeAction) ProtoMessage() {} func (x *DeleteMessageForMeAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[128] + mi := &file_binary_proto_def_proto_msgTypes[132] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15054,7 +15524,7 @@ func (x *DeleteMessageForMeAction) ProtoReflect() protoreflect.Message { // Deprecated: Use DeleteMessageForMeAction.ProtoReflect.Descriptor instead. func (*DeleteMessageForMeAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{128} + return file_binary_proto_def_proto_rawDescGZIP(), []int{132} } func (x *DeleteMessageForMeAction) GetDeleteMedia() bool { @@ -15082,7 +15552,7 @@ type DeleteChatAction struct { func (x *DeleteChatAction) Reset() { *x = DeleteChatAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[129] + mi := &file_binary_proto_def_proto_msgTypes[133] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15095,7 +15565,7 @@ func (x *DeleteChatAction) String() string { func (*DeleteChatAction) ProtoMessage() {} func (x *DeleteChatAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[129] + mi := &file_binary_proto_def_proto_msgTypes[133] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15108,7 +15578,7 @@ func (x *DeleteChatAction) ProtoReflect() protoreflect.Message { // Deprecated: Use DeleteChatAction.ProtoReflect.Descriptor instead. func (*DeleteChatAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{129} + return file_binary_proto_def_proto_rawDescGZIP(), []int{133} } func (x *DeleteChatAction) GetMessageRange() *SyncActionMessageRange { @@ -15131,7 +15601,7 @@ type ContactAction struct { func (x *ContactAction) Reset() { *x = ContactAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[130] + mi := &file_binary_proto_def_proto_msgTypes[134] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15144,7 +15614,7 @@ func (x *ContactAction) String() string { func (*ContactAction) ProtoMessage() {} func (x *ContactAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[130] + mi := &file_binary_proto_def_proto_msgTypes[134] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15157,7 +15627,7 @@ func (x *ContactAction) ProtoReflect() protoreflect.Message { // Deprecated: Use ContactAction.ProtoReflect.Descriptor instead. func (*ContactAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{130} + return file_binary_proto_def_proto_rawDescGZIP(), []int{134} } func (x *ContactAction) GetFullName() string { @@ -15192,7 +15662,7 @@ type ClearChatAction struct { func (x *ClearChatAction) Reset() { *x = ClearChatAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[131] + mi := &file_binary_proto_def_proto_msgTypes[135] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15205,7 +15675,7 @@ func (x *ClearChatAction) String() string { func (*ClearChatAction) ProtoMessage() {} func (x *ClearChatAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[131] + mi := &file_binary_proto_def_proto_msgTypes[135] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15218,7 +15688,7 @@ func (x *ClearChatAction) ProtoReflect() protoreflect.Message { // Deprecated: Use ClearChatAction.ProtoReflect.Descriptor instead. func (*ClearChatAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{131} + return file_binary_proto_def_proto_rawDescGZIP(), []int{135} } func (x *ClearChatAction) GetMessageRange() *SyncActionMessageRange { @@ -15239,7 +15709,7 @@ type ChatAssignmentOpenedStatusAction struct { func (x *ChatAssignmentOpenedStatusAction) Reset() { *x = ChatAssignmentOpenedStatusAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[132] + mi := &file_binary_proto_def_proto_msgTypes[136] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15252,7 +15722,7 @@ func (x *ChatAssignmentOpenedStatusAction) String() string { func (*ChatAssignmentOpenedStatusAction) ProtoMessage() {} func (x *ChatAssignmentOpenedStatusAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[132] + mi := &file_binary_proto_def_proto_msgTypes[136] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15265,7 +15735,7 @@ func (x *ChatAssignmentOpenedStatusAction) ProtoReflect() protoreflect.Message { // Deprecated: Use ChatAssignmentOpenedStatusAction.ProtoReflect.Descriptor instead. func (*ChatAssignmentOpenedStatusAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{132} + return file_binary_proto_def_proto_rawDescGZIP(), []int{136} } func (x *ChatAssignmentOpenedStatusAction) GetChatOpened() bool { @@ -15286,7 +15756,7 @@ type ChatAssignmentAction struct { func (x *ChatAssignmentAction) Reset() { *x = ChatAssignmentAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[133] + mi := &file_binary_proto_def_proto_msgTypes[137] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15299,7 +15769,7 @@ func (x *ChatAssignmentAction) String() string { func (*ChatAssignmentAction) ProtoMessage() {} func (x *ChatAssignmentAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[133] + mi := &file_binary_proto_def_proto_msgTypes[137] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15312,7 +15782,7 @@ func (x *ChatAssignmentAction) ProtoReflect() protoreflect.Message { // Deprecated: Use ChatAssignmentAction.ProtoReflect.Descriptor instead. func (*ChatAssignmentAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{133} + return file_binary_proto_def_proto_rawDescGZIP(), []int{137} } func (x *ChatAssignmentAction) GetDeviceAgentID() string { @@ -15334,7 +15804,7 @@ type ArchiveChatAction struct { func (x *ArchiveChatAction) Reset() { *x = ArchiveChatAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[134] + mi := &file_binary_proto_def_proto_msgTypes[138] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15347,7 +15817,7 @@ func (x *ArchiveChatAction) String() string { func (*ArchiveChatAction) ProtoMessage() {} func (x *ArchiveChatAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[134] + mi := &file_binary_proto_def_proto_msgTypes[138] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15360,7 +15830,7 @@ func (x *ArchiveChatAction) ProtoReflect() protoreflect.Message { // Deprecated: Use ArchiveChatAction.ProtoReflect.Descriptor instead. func (*ArchiveChatAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{134} + return file_binary_proto_def_proto_rawDescGZIP(), []int{138} } func (x *ArchiveChatAction) GetArchived() bool { @@ -15388,7 +15858,7 @@ type AndroidUnsupportedActions struct { func (x *AndroidUnsupportedActions) Reset() { *x = AndroidUnsupportedActions{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[135] + mi := &file_binary_proto_def_proto_msgTypes[139] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15401,7 +15871,7 @@ func (x *AndroidUnsupportedActions) String() string { func (*AndroidUnsupportedActions) ProtoMessage() {} func (x *AndroidUnsupportedActions) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[135] + mi := &file_binary_proto_def_proto_msgTypes[139] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15414,7 +15884,7 @@ func (x *AndroidUnsupportedActions) ProtoReflect() protoreflect.Message { // Deprecated: Use AndroidUnsupportedActions.ProtoReflect.Descriptor instead. func (*AndroidUnsupportedActions) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{135} + return file_binary_proto_def_proto_rawDescGZIP(), []int{139} } func (x *AndroidUnsupportedActions) GetAllowed() bool { @@ -15437,7 +15907,7 @@ type AgentAction struct { func (x *AgentAction) Reset() { *x = AgentAction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[136] + mi := &file_binary_proto_def_proto_msgTypes[140] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15450,7 +15920,7 @@ func (x *AgentAction) String() string { func (*AgentAction) ProtoMessage() {} func (x *AgentAction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[136] + mi := &file_binary_proto_def_proto_msgTypes[140] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15463,7 +15933,7 @@ func (x *AgentAction) ProtoReflect() protoreflect.Message { // Deprecated: Use AgentAction.ProtoReflect.Descriptor instead. func (*AgentAction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{136} + return file_binary_proto_def_proto_rawDescGZIP(), []int{140} } func (x *AgentAction) GetName() string { @@ -15501,7 +15971,7 @@ type SyncActionData struct { func (x *SyncActionData) Reset() { *x = SyncActionData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[137] + mi := &file_binary_proto_def_proto_msgTypes[141] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15514,7 +15984,7 @@ func (x *SyncActionData) String() string { func (*SyncActionData) ProtoMessage() {} func (x *SyncActionData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[137] + mi := &file_binary_proto_def_proto_msgTypes[141] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15527,7 +15997,7 @@ func (x *SyncActionData) ProtoReflect() protoreflect.Message { // Deprecated: Use SyncActionData.ProtoReflect.Descriptor instead. func (*SyncActionData) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{137} + return file_binary_proto_def_proto_rawDescGZIP(), []int{141} } func (x *SyncActionData) GetIndex() []byte { @@ -15570,7 +16040,7 @@ type RecentEmojiWeight struct { func (x *RecentEmojiWeight) Reset() { *x = RecentEmojiWeight{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[138] + mi := &file_binary_proto_def_proto_msgTypes[142] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15583,7 +16053,7 @@ func (x *RecentEmojiWeight) String() string { func (*RecentEmojiWeight) ProtoMessage() {} func (x *RecentEmojiWeight) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[138] + mi := &file_binary_proto_def_proto_msgTypes[142] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15596,7 +16066,7 @@ func (x *RecentEmojiWeight) ProtoReflect() protoreflect.Message { // Deprecated: Use RecentEmojiWeight.ProtoReflect.Descriptor instead. func (*RecentEmojiWeight) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{138} + return file_binary_proto_def_proto_rawDescGZIP(), []int{142} } func (x *RecentEmojiWeight) GetEmoji() string { @@ -15626,7 +16096,7 @@ type VerifiedNameCertificate struct { func (x *VerifiedNameCertificate) Reset() { *x = VerifiedNameCertificate{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[139] + mi := &file_binary_proto_def_proto_msgTypes[143] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15639,7 +16109,7 @@ func (x *VerifiedNameCertificate) String() string { func (*VerifiedNameCertificate) ProtoMessage() {} func (x *VerifiedNameCertificate) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[139] + mi := &file_binary_proto_def_proto_msgTypes[143] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15652,7 +16122,7 @@ func (x *VerifiedNameCertificate) ProtoReflect() protoreflect.Message { // Deprecated: Use VerifiedNameCertificate.ProtoReflect.Descriptor instead. func (*VerifiedNameCertificate) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{139} + return file_binary_proto_def_proto_rawDescGZIP(), []int{143} } func (x *VerifiedNameCertificate) GetDetails() []byte { @@ -15689,7 +16159,7 @@ type LocalizedName struct { func (x *LocalizedName) Reset() { *x = LocalizedName{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[140] + mi := &file_binary_proto_def_proto_msgTypes[144] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15702,7 +16172,7 @@ func (x *LocalizedName) String() string { func (*LocalizedName) ProtoMessage() {} func (x *LocalizedName) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[140] + mi := &file_binary_proto_def_proto_msgTypes[144] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15715,7 +16185,7 @@ func (x *LocalizedName) ProtoReflect() protoreflect.Message { // Deprecated: Use LocalizedName.ProtoReflect.Descriptor instead. func (*LocalizedName) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{140} + return file_binary_proto_def_proto_rawDescGZIP(), []int{144} } func (x *LocalizedName) GetLg() string { @@ -15757,7 +16227,7 @@ type BizIdentityInfo struct { func (x *BizIdentityInfo) Reset() { *x = BizIdentityInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[141] + mi := &file_binary_proto_def_proto_msgTypes[145] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15770,7 +16240,7 @@ func (x *BizIdentityInfo) String() string { func (*BizIdentityInfo) ProtoMessage() {} func (x *BizIdentityInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[141] + mi := &file_binary_proto_def_proto_msgTypes[145] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15783,7 +16253,7 @@ func (x *BizIdentityInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use BizIdentityInfo.ProtoReflect.Descriptor instead. func (*BizIdentityInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{141} + return file_binary_proto_def_proto_rawDescGZIP(), []int{145} } func (x *BizIdentityInfo) GetVlevel() BizIdentityInfo_VerifiedLevelValue { @@ -15854,7 +16324,7 @@ type BizAccountPayload struct { func (x *BizAccountPayload) Reset() { *x = BizAccountPayload{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[142] + mi := &file_binary_proto_def_proto_msgTypes[146] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15867,7 +16337,7 @@ func (x *BizAccountPayload) String() string { func (*BizAccountPayload) ProtoMessage() {} func (x *BizAccountPayload) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[142] + mi := &file_binary_proto_def_proto_msgTypes[146] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15880,7 +16350,7 @@ func (x *BizAccountPayload) ProtoReflect() protoreflect.Message { // Deprecated: Use BizAccountPayload.ProtoReflect.Descriptor instead. func (*BizAccountPayload) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{142} + return file_binary_proto_def_proto_rawDescGZIP(), []int{146} } func (x *BizAccountPayload) GetVnameCert() *VerifiedNameCertificate { @@ -15912,7 +16382,7 @@ type BizAccountLinkInfo struct { func (x *BizAccountLinkInfo) Reset() { *x = BizAccountLinkInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[143] + mi := &file_binary_proto_def_proto_msgTypes[147] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -15925,7 +16395,7 @@ func (x *BizAccountLinkInfo) String() string { func (*BizAccountLinkInfo) ProtoMessage() {} func (x *BizAccountLinkInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[143] + mi := &file_binary_proto_def_proto_msgTypes[147] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -15938,7 +16408,7 @@ func (x *BizAccountLinkInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use BizAccountLinkInfo.ProtoReflect.Descriptor instead. func (*BizAccountLinkInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{143} + return file_binary_proto_def_proto_rawDescGZIP(), []int{147} } func (x *BizAccountLinkInfo) GetWhatsappBizAcctFbid() uint64 { @@ -15989,7 +16459,7 @@ type HandshakeMessage struct { func (x *HandshakeMessage) Reset() { *x = HandshakeMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[144] + mi := &file_binary_proto_def_proto_msgTypes[148] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16002,7 +16472,7 @@ func (x *HandshakeMessage) String() string { func (*HandshakeMessage) ProtoMessage() {} func (x *HandshakeMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[144] + mi := &file_binary_proto_def_proto_msgTypes[148] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16015,7 +16485,7 @@ func (x *HandshakeMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use HandshakeMessage.ProtoReflect.Descriptor instead. func (*HandshakeMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{144} + return file_binary_proto_def_proto_rawDescGZIP(), []int{148} } func (x *HandshakeMessage) GetClientHello() *HandshakeClientHello { @@ -16052,7 +16522,7 @@ type HandshakeServerHello struct { func (x *HandshakeServerHello) Reset() { *x = HandshakeServerHello{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[145] + mi := &file_binary_proto_def_proto_msgTypes[149] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16065,7 +16535,7 @@ func (x *HandshakeServerHello) String() string { func (*HandshakeServerHello) ProtoMessage() {} func (x *HandshakeServerHello) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[145] + mi := &file_binary_proto_def_proto_msgTypes[149] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16078,7 +16548,7 @@ func (x *HandshakeServerHello) ProtoReflect() protoreflect.Message { // Deprecated: Use HandshakeServerHello.ProtoReflect.Descriptor instead. func (*HandshakeServerHello) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{145} + return file_binary_proto_def_proto_rawDescGZIP(), []int{149} } func (x *HandshakeServerHello) GetEphemeral() []byte { @@ -16115,7 +16585,7 @@ type HandshakeClientHello struct { func (x *HandshakeClientHello) Reset() { *x = HandshakeClientHello{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[146] + mi := &file_binary_proto_def_proto_msgTypes[150] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16128,7 +16598,7 @@ func (x *HandshakeClientHello) String() string { func (*HandshakeClientHello) ProtoMessage() {} func (x *HandshakeClientHello) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[146] + mi := &file_binary_proto_def_proto_msgTypes[150] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16141,7 +16611,7 @@ func (x *HandshakeClientHello) ProtoReflect() protoreflect.Message { // Deprecated: Use HandshakeClientHello.ProtoReflect.Descriptor instead. func (*HandshakeClientHello) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{146} + return file_binary_proto_def_proto_rawDescGZIP(), []int{150} } func (x *HandshakeClientHello) GetEphemeral() []byte { @@ -16177,7 +16647,7 @@ type HandshakeClientFinish struct { func (x *HandshakeClientFinish) Reset() { *x = HandshakeClientFinish{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[147] + mi := &file_binary_proto_def_proto_msgTypes[151] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16190,7 +16660,7 @@ func (x *HandshakeClientFinish) String() string { func (*HandshakeClientFinish) ProtoMessage() {} func (x *HandshakeClientFinish) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[147] + mi := &file_binary_proto_def_proto_msgTypes[151] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16203,7 +16673,7 @@ func (x *HandshakeClientFinish) ProtoReflect() protoreflect.Message { // Deprecated: Use HandshakeClientFinish.ProtoReflect.Descriptor instead. func (*HandshakeClientFinish) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{147} + return file_binary_proto_def_proto_rawDescGZIP(), []int{151} } func (x *HandshakeClientFinish) GetStatic() []byte { @@ -16249,7 +16719,6 @@ type ClientPayload struct { FbDeviceId []byte `protobuf:"bytes,32,opt,name=fbDeviceId" json:"fbDeviceId,omitempty"` Pull *bool `protobuf:"varint,33,opt,name=pull" json:"pull,omitempty"` PaddingBytes []byte `protobuf:"bytes,34,opt,name=paddingBytes" json:"paddingBytes,omitempty"` - BizMarketSegment *ClientPayload_BizMarketSegment `protobuf:"varint,35,opt,name=bizMarketSegment,enum=proto.ClientPayload_BizMarketSegment" json:"bizMarketSegment,omitempty"` YearClass *int32 `protobuf:"varint,36,opt,name=yearClass" json:"yearClass,omitempty"` MemClass *int32 `protobuf:"varint,37,opt,name=memClass" json:"memClass,omitempty"` } @@ -16257,7 +16726,7 @@ type ClientPayload struct { func (x *ClientPayload) Reset() { *x = ClientPayload{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[148] + mi := &file_binary_proto_def_proto_msgTypes[152] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16270,7 +16739,7 @@ func (x *ClientPayload) String() string { func (*ClientPayload) ProtoMessage() {} func (x *ClientPayload) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[148] + mi := &file_binary_proto_def_proto_msgTypes[152] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16283,7 +16752,7 @@ func (x *ClientPayload) ProtoReflect() protoreflect.Message { // Deprecated: Use ClientPayload.ProtoReflect.Descriptor instead. func (*ClientPayload) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152} } func (x *ClientPayload) GetUsername() uint64 { @@ -16454,13 +16923,6 @@ func (x *ClientPayload) GetPaddingBytes() []byte { return nil } -func (x *ClientPayload) GetBizMarketSegment() ClientPayload_BizMarketSegment { - if x != nil && x.BizMarketSegment != nil { - return *x.BizMarketSegment - } - return ClientPayload_DEFAULT -} - func (x *ClientPayload) GetYearClass() int32 { if x != nil && x.YearClass != nil { return *x.YearClass @@ -16489,7 +16951,7 @@ type WebNotificationsInfo struct { func (x *WebNotificationsInfo) Reset() { *x = WebNotificationsInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[149] + mi := &file_binary_proto_def_proto_msgTypes[153] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16502,7 +16964,7 @@ func (x *WebNotificationsInfo) String() string { func (*WebNotificationsInfo) ProtoMessage() {} func (x *WebNotificationsInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[149] + mi := &file_binary_proto_def_proto_msgTypes[153] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16515,7 +16977,7 @@ func (x *WebNotificationsInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use WebNotificationsInfo.ProtoReflect.Descriptor instead. func (*WebNotificationsInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{149} + return file_binary_proto_def_proto_rawDescGZIP(), []int{153} } func (x *WebNotificationsInfo) GetTimestamp() uint64 { @@ -16599,7 +17061,7 @@ type WebMessageInfo struct { func (x *WebMessageInfo) Reset() { *x = WebMessageInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[150] + mi := &file_binary_proto_def_proto_msgTypes[154] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16612,7 +17074,7 @@ func (x *WebMessageInfo) String() string { func (*WebMessageInfo) ProtoMessage() {} func (x *WebMessageInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[150] + mi := &file_binary_proto_def_proto_msgTypes[154] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -16625,7 +17087,7 @@ func (x *WebMessageInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use WebMessageInfo.ProtoReflect.Descriptor instead. func (*WebMessageInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{150} + return file_binary_proto_def_proto_rawDescGZIP(), []int{154} } func (x *WebMessageInfo) GetKey() *MessageKey { @@ -16984,7 +17446,7 @@ type WebFeatures struct { func (x *WebFeatures) Reset() { *x = WebFeatures{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[151] + mi := &file_binary_proto_def_proto_msgTypes[155] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -16997,7 +17459,7 @@ func (x *WebFeatures) String() string { func (*WebFeatures) ProtoMessage() {} func (x *WebFeatures) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[151] + mi := &file_binary_proto_def_proto_msgTypes[155] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17010,7 +17472,7 @@ func (x *WebFeatures) ProtoReflect() protoreflect.Message { // Deprecated: Use WebFeatures.ProtoReflect.Descriptor instead. func (*WebFeatures) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{151} + return file_binary_proto_def_proto_rawDescGZIP(), []int{155} } func (x *WebFeatures) GetLabelsDisplay() WebFeatures_Flag { @@ -17344,7 +17806,7 @@ type UserReceipt struct { func (x *UserReceipt) Reset() { *x = UserReceipt{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[152] + mi := &file_binary_proto_def_proto_msgTypes[156] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17357,7 +17819,7 @@ func (x *UserReceipt) String() string { func (*UserReceipt) ProtoMessage() {} func (x *UserReceipt) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[152] + mi := &file_binary_proto_def_proto_msgTypes[156] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17370,7 +17832,7 @@ func (x *UserReceipt) ProtoReflect() protoreflect.Message { // Deprecated: Use UserReceipt.ProtoReflect.Descriptor instead. func (*UserReceipt) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{152} + return file_binary_proto_def_proto_rawDescGZIP(), []int{156} } func (x *UserReceipt) GetUserJid() string { @@ -17427,7 +17889,7 @@ type StatusPSA struct { func (x *StatusPSA) Reset() { *x = StatusPSA{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[153] + mi := &file_binary_proto_def_proto_msgTypes[157] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17440,7 +17902,7 @@ func (x *StatusPSA) String() string { func (*StatusPSA) ProtoMessage() {} func (x *StatusPSA) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[153] + mi := &file_binary_proto_def_proto_msgTypes[157] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17453,7 +17915,7 @@ func (x *StatusPSA) ProtoReflect() protoreflect.Message { // Deprecated: Use StatusPSA.ProtoReflect.Descriptor instead. func (*StatusPSA) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{153} + return file_binary_proto_def_proto_rawDescGZIP(), []int{157} } func (x *StatusPSA) GetCampaignId() uint64 { @@ -17485,7 +17947,7 @@ type Reaction struct { func (x *Reaction) Reset() { *x = Reaction{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[154] + mi := &file_binary_proto_def_proto_msgTypes[158] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17498,7 +17960,7 @@ func (x *Reaction) String() string { func (*Reaction) ProtoMessage() {} func (x *Reaction) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[154] + mi := &file_binary_proto_def_proto_msgTypes[158] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17511,7 +17973,7 @@ func (x *Reaction) ProtoReflect() protoreflect.Message { // Deprecated: Use Reaction.ProtoReflect.Descriptor instead. func (*Reaction) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{154} + return file_binary_proto_def_proto_rawDescGZIP(), []int{158} } func (x *Reaction) GetKey() *MessageKey { @@ -17558,12 +18020,13 @@ type PollUpdate struct { Vote *PollVoteMessage `protobuf:"bytes,2,opt,name=vote" json:"vote,omitempty"` SenderTimestampMs *int64 `protobuf:"varint,3,opt,name=senderTimestampMs" json:"senderTimestampMs,omitempty"` ServerTimestampMs *int64 `protobuf:"varint,4,opt,name=serverTimestampMs" json:"serverTimestampMs,omitempty"` + Unread *bool `protobuf:"varint,5,opt,name=unread" json:"unread,omitempty"` } func (x *PollUpdate) Reset() { *x = PollUpdate{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[155] + mi := &file_binary_proto_def_proto_msgTypes[159] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17576,7 +18039,7 @@ func (x *PollUpdate) String() string { func (*PollUpdate) ProtoMessage() {} func (x *PollUpdate) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[155] + mi := &file_binary_proto_def_proto_msgTypes[159] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17589,7 +18052,7 @@ func (x *PollUpdate) ProtoReflect() protoreflect.Message { // Deprecated: Use PollUpdate.ProtoReflect.Descriptor instead. func (*PollUpdate) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{155} + return file_binary_proto_def_proto_rawDescGZIP(), []int{159} } func (x *PollUpdate) GetPollUpdateMessageKey() *MessageKey { @@ -17620,6 +18083,13 @@ func (x *PollUpdate) GetServerTimestampMs() int64 { return 0 } +func (x *PollUpdate) GetUnread() bool { + if x != nil && x.Unread != nil { + return *x.Unread + } + return false +} + type PollAdditionalMetadata struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -17631,7 +18101,7 @@ type PollAdditionalMetadata struct { func (x *PollAdditionalMetadata) Reset() { *x = PollAdditionalMetadata{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[156] + mi := &file_binary_proto_def_proto_msgTypes[160] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17644,7 +18114,7 @@ func (x *PollAdditionalMetadata) String() string { func (*PollAdditionalMetadata) ProtoMessage() {} func (x *PollAdditionalMetadata) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[156] + mi := &file_binary_proto_def_proto_msgTypes[160] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17657,7 +18127,7 @@ func (x *PollAdditionalMetadata) ProtoReflect() protoreflect.Message { // Deprecated: Use PollAdditionalMetadata.ProtoReflect.Descriptor instead. func (*PollAdditionalMetadata) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{156} + return file_binary_proto_def_proto_rawDescGZIP(), []int{160} } func (x *PollAdditionalMetadata) GetPollInvalidated() bool { @@ -17680,7 +18150,7 @@ type PhotoChange struct { func (x *PhotoChange) Reset() { *x = PhotoChange{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[157] + mi := &file_binary_proto_def_proto_msgTypes[161] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17693,7 +18163,7 @@ func (x *PhotoChange) String() string { func (*PhotoChange) ProtoMessage() {} func (x *PhotoChange) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[157] + mi := &file_binary_proto_def_proto_msgTypes[161] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17706,7 +18176,7 @@ func (x *PhotoChange) ProtoReflect() protoreflect.Message { // Deprecated: Use PhotoChange.ProtoReflect.Descriptor instead. func (*PhotoChange) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{157} + return file_binary_proto_def_proto_rawDescGZIP(), []int{161} } func (x *PhotoChange) GetOldPhoto() []byte { @@ -17753,7 +18223,7 @@ type PaymentInfo struct { func (x *PaymentInfo) Reset() { *x = PaymentInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[158] + mi := &file_binary_proto_def_proto_msgTypes[162] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17766,7 +18236,7 @@ func (x *PaymentInfo) String() string { func (*PaymentInfo) ProtoMessage() {} func (x *PaymentInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[158] + mi := &file_binary_proto_def_proto_msgTypes[162] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17779,7 +18249,7 @@ func (x *PaymentInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use PaymentInfo.ProtoReflect.Descriptor instead. func (*PaymentInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{158} + return file_binary_proto_def_proto_rawDescGZIP(), []int{162} } func (x *PaymentInfo) GetCurrencyDeprecated() PaymentInfo_Currency { @@ -17887,7 +18357,7 @@ type NotificationMessageInfo struct { func (x *NotificationMessageInfo) Reset() { *x = NotificationMessageInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[159] + mi := &file_binary_proto_def_proto_msgTypes[163] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17900,7 +18370,7 @@ func (x *NotificationMessageInfo) String() string { func (*NotificationMessageInfo) ProtoMessage() {} func (x *NotificationMessageInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[159] + mi := &file_binary_proto_def_proto_msgTypes[163] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17913,7 +18383,7 @@ func (x *NotificationMessageInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use NotificationMessageInfo.ProtoReflect.Descriptor instead. func (*NotificationMessageInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{159} + return file_binary_proto_def_proto_rawDescGZIP(), []int{163} } func (x *NotificationMessageInfo) GetKey() *MessageKey { @@ -17955,7 +18425,7 @@ type MediaData struct { func (x *MediaData) Reset() { *x = MediaData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[160] + mi := &file_binary_proto_def_proto_msgTypes[164] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -17968,7 +18438,7 @@ func (x *MediaData) String() string { func (*MediaData) ProtoMessage() {} func (x *MediaData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[160] + mi := &file_binary_proto_def_proto_msgTypes[164] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -17981,7 +18451,7 @@ func (x *MediaData) ProtoReflect() protoreflect.Message { // Deprecated: Use MediaData.ProtoReflect.Descriptor instead. func (*MediaData) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{160} + return file_binary_proto_def_proto_rawDescGZIP(), []int{164} } func (x *MediaData) GetLocalPath() string { @@ -18007,7 +18477,7 @@ type KeepInChat struct { func (x *KeepInChat) Reset() { *x = KeepInChat{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[161] + mi := &file_binary_proto_def_proto_msgTypes[165] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18020,7 +18490,7 @@ func (x *KeepInChat) String() string { func (*KeepInChat) ProtoMessage() {} func (x *KeepInChat) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[161] + mi := &file_binary_proto_def_proto_msgTypes[165] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18033,7 +18503,7 @@ func (x *KeepInChat) ProtoReflect() protoreflect.Message { // Deprecated: Use KeepInChat.ProtoReflect.Descriptor instead. func (*KeepInChat) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{161} + return file_binary_proto_def_proto_rawDescGZIP(), []int{165} } func (x *KeepInChat) GetKeepType() KeepType { @@ -18090,7 +18560,7 @@ type NoiseCertificate struct { func (x *NoiseCertificate) Reset() { *x = NoiseCertificate{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[162] + mi := &file_binary_proto_def_proto_msgTypes[166] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18103,7 +18573,7 @@ func (x *NoiseCertificate) String() string { func (*NoiseCertificate) ProtoMessage() {} func (x *NoiseCertificate) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[162] + mi := &file_binary_proto_def_proto_msgTypes[166] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18116,7 +18586,7 @@ func (x *NoiseCertificate) ProtoReflect() protoreflect.Message { // Deprecated: Use NoiseCertificate.ProtoReflect.Descriptor instead. func (*NoiseCertificate) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{162} + return file_binary_proto_def_proto_rawDescGZIP(), []int{166} } func (x *NoiseCertificate) GetDetails() []byte { @@ -18145,7 +18615,7 @@ type CertChain struct { func (x *CertChain) Reset() { *x = CertChain{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[163] + mi := &file_binary_proto_def_proto_msgTypes[167] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18158,7 +18628,7 @@ func (x *CertChain) String() string { func (*CertChain) ProtoMessage() {} func (x *CertChain) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[163] + mi := &file_binary_proto_def_proto_msgTypes[167] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18171,7 +18641,7 @@ func (x *CertChain) ProtoReflect() protoreflect.Message { // Deprecated: Use CertChain.ProtoReflect.Descriptor instead. func (*CertChain) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{163} + return file_binary_proto_def_proto_rawDescGZIP(), []int{167} } func (x *CertChain) GetLeaf() *CertChain_NoiseCertificate { @@ -18201,7 +18671,7 @@ type DeviceProps_HistorySyncConfig struct { func (x *DeviceProps_HistorySyncConfig) Reset() { *x = DeviceProps_HistorySyncConfig{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[164] + mi := &file_binary_proto_def_proto_msgTypes[168] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18214,7 +18684,7 @@ func (x *DeviceProps_HistorySyncConfig) String() string { func (*DeviceProps_HistorySyncConfig) ProtoMessage() {} func (x *DeviceProps_HistorySyncConfig) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[164] + mi := &file_binary_proto_def_proto_msgTypes[168] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18266,7 +18736,7 @@ type DeviceProps_AppVersion struct { func (x *DeviceProps_AppVersion) Reset() { *x = DeviceProps_AppVersion{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[165] + mi := &file_binary_proto_def_proto_msgTypes[169] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18279,7 +18749,7 @@ func (x *DeviceProps_AppVersion) String() string { func (*DeviceProps_AppVersion) ProtoMessage() {} func (x *DeviceProps_AppVersion) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[165] + mi := &file_binary_proto_def_proto_msgTypes[169] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18330,165 +18800,6 @@ func (x *DeviceProps_AppVersion) GetQuinary() uint32 { return 0 } -type PeerDataOperationRequestResponseMessage_PeerDataOperationResult struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - MediaUploadResult *MediaRetryNotification_ResultType `protobuf:"varint,1,opt,name=mediaUploadResult,enum=proto.MediaRetryNotification_ResultType" json:"mediaUploadResult,omitempty"` - StickerMessage *StickerMessage `protobuf:"bytes,2,opt,name=stickerMessage" json:"stickerMessage,omitempty"` - LinkPreviewResponse *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse `protobuf:"bytes,3,opt,name=linkPreviewResponse" json:"linkPreviewResponse,omitempty"` -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) Reset() { - *x = PeerDataOperationRequestResponseMessage_PeerDataOperationResult{} - if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[166] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult) ProtoMessage() {} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[166] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use PeerDataOperationRequestResponseMessage_PeerDataOperationResult.ProtoReflect.Descriptor instead. -func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{6, 0} -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) GetMediaUploadResult() MediaRetryNotification_ResultType { - if x != nil && x.MediaUploadResult != nil { - return *x.MediaUploadResult - } - return MediaRetryNotification_GENERAL_ERROR -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) GetStickerMessage() *StickerMessage { - if x != nil { - return x.StickerMessage - } - return nil -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) GetLinkPreviewResponse() *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse { - if x != nil { - return x.LinkPreviewResponse - } - return nil -} - -type PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse struct { - state protoimpl.MessageState - sizeCache protoimpl.SizeCache - unknownFields protoimpl.UnknownFields - - Url *string `protobuf:"bytes,1,opt,name=url" json:"url,omitempty"` - Title *string `protobuf:"bytes,2,opt,name=title" json:"title,omitempty"` - Description *string `protobuf:"bytes,3,opt,name=description" json:"description,omitempty"` - ThumbData []byte `protobuf:"bytes,4,opt,name=thumbData" json:"thumbData,omitempty"` - CanonicalUrl *string `protobuf:"bytes,5,opt,name=canonicalUrl" json:"canonicalUrl,omitempty"` - MatchText *string `protobuf:"bytes,6,opt,name=matchText" json:"matchText,omitempty"` - PreviewType *string `protobuf:"bytes,7,opt,name=previewType" json:"previewType,omitempty"` -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) Reset() { - *x = PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse{} - if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[167] - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - ms.StoreMessageInfo(mi) - } -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) String() string { - return protoimpl.X.MessageStringOf(x) -} - -func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) ProtoMessage() { -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[167] - if protoimpl.UnsafeEnabled && x != nil { - ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) - if ms.LoadMessageInfo() == nil { - ms.StoreMessageInfo(mi) - } - return ms - } - return mi.MessageOf(x) -} - -// Deprecated: Use PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse.ProtoReflect.Descriptor instead. -func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{6, 0, 0} -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetUrl() string { - if x != nil && x.Url != nil { - return *x.Url - } - return "" -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetTitle() string { - if x != nil && x.Title != nil { - return *x.Title - } - return "" -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetDescription() string { - if x != nil && x.Description != nil { - return *x.Description - } - return "" -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetThumbData() []byte { - if x != nil { - return x.ThumbData - } - return nil -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetCanonicalUrl() string { - if x != nil && x.CanonicalUrl != nil { - return *x.CanonicalUrl - } - return "" -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetMatchText() string { - if x != nil && x.MatchText != nil { - return *x.MatchText - } - return "" -} - -func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetPreviewType() string { - if x != nil && x.PreviewType != nil { - return *x.PreviewType - } - return "" -} - type PeerDataOperationRequestMessage_RequestUrlPreview struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -18500,7 +18811,7 @@ type PeerDataOperationRequestMessage_RequestUrlPreview struct { func (x *PeerDataOperationRequestMessage_RequestUrlPreview) Reset() { *x = PeerDataOperationRequestMessage_RequestUrlPreview{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[168] + mi := &file_binary_proto_def_proto_msgTypes[170] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18513,7 +18824,7 @@ func (x *PeerDataOperationRequestMessage_RequestUrlPreview) String() string { func (*PeerDataOperationRequestMessage_RequestUrlPreview) ProtoMessage() {} func (x *PeerDataOperationRequestMessage_RequestUrlPreview) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[168] + mi := &file_binary_proto_def_proto_msgTypes[170] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18526,7 +18837,7 @@ func (x *PeerDataOperationRequestMessage_RequestUrlPreview) ProtoReflect() proto // Deprecated: Use PeerDataOperationRequestMessage_RequestUrlPreview.ProtoReflect.Descriptor instead. func (*PeerDataOperationRequestMessage_RequestUrlPreview) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{7, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{6, 0} } func (x *PeerDataOperationRequestMessage_RequestUrlPreview) GetUrl() string { @@ -18547,7 +18858,7 @@ type PeerDataOperationRequestMessage_RequestStickerReupload struct { func (x *PeerDataOperationRequestMessage_RequestStickerReupload) Reset() { *x = PeerDataOperationRequestMessage_RequestStickerReupload{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[169] + mi := &file_binary_proto_def_proto_msgTypes[171] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18560,7 +18871,7 @@ func (x *PeerDataOperationRequestMessage_RequestStickerReupload) String() string func (*PeerDataOperationRequestMessage_RequestStickerReupload) ProtoMessage() {} func (x *PeerDataOperationRequestMessage_RequestStickerReupload) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[169] + mi := &file_binary_proto_def_proto_msgTypes[171] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18573,7 +18884,7 @@ func (x *PeerDataOperationRequestMessage_RequestStickerReupload) ProtoReflect() // Deprecated: Use PeerDataOperationRequestMessage_RequestStickerReupload.ProtoReflect.Descriptor instead. func (*PeerDataOperationRequestMessage_RequestStickerReupload) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{7, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{6, 1} } func (x *PeerDataOperationRequestMessage_RequestStickerReupload) GetFileSha256() string { @@ -18583,6 +18894,85 @@ func (x *PeerDataOperationRequestMessage_RequestStickerReupload) GetFileSha256() return "" } +type PeerDataOperationRequestMessage_HistorySyncOnDemandRequest struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + ChatJid *string `protobuf:"bytes,1,opt,name=chatJid" json:"chatJid,omitempty"` + OldestMsgId *string `protobuf:"bytes,2,opt,name=oldestMsgId" json:"oldestMsgId,omitempty"` + OldestMsgFromMe *bool `protobuf:"varint,3,opt,name=oldestMsgFromMe" json:"oldestMsgFromMe,omitempty"` + OnDemandMsgCount *int32 `protobuf:"varint,4,opt,name=onDemandMsgCount" json:"onDemandMsgCount,omitempty"` + OldestMsgTimestampMs *int64 `protobuf:"varint,5,opt,name=oldestMsgTimestampMs" json:"oldestMsgTimestampMs,omitempty"` +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) Reset() { + *x = PeerDataOperationRequestMessage_HistorySyncOnDemandRequest{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[172] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) ProtoMessage() {} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[172] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use PeerDataOperationRequestMessage_HistorySyncOnDemandRequest.ProtoReflect.Descriptor instead. +func (*PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{6, 2} +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) GetChatJid() string { + if x != nil && x.ChatJid != nil { + return *x.ChatJid + } + return "" +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) GetOldestMsgId() string { + if x != nil && x.OldestMsgId != nil { + return *x.OldestMsgId + } + return "" +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) GetOldestMsgFromMe() bool { + if x != nil && x.OldestMsgFromMe != nil { + return *x.OldestMsgFromMe + } + return false +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) GetOnDemandMsgCount() int32 { + if x != nil && x.OnDemandMsgCount != nil { + return *x.OnDemandMsgCount + } + return 0 +} + +func (x *PeerDataOperationRequestMessage_HistorySyncOnDemandRequest) GetOldestMsgTimestampMs() int64 { + if x != nil && x.OldestMsgTimestampMs != nil { + return *x.OldestMsgTimestampMs + } + return 0 +} + type ListResponseMessage_SingleSelectReply struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -18594,7 +18984,7 @@ type ListResponseMessage_SingleSelectReply struct { func (x *ListResponseMessage_SingleSelectReply) Reset() { *x = ListResponseMessage_SingleSelectReply{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[170] + mi := &file_binary_proto_def_proto_msgTypes[173] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18607,7 +18997,7 @@ func (x *ListResponseMessage_SingleSelectReply) String() string { func (*ListResponseMessage_SingleSelectReply) ProtoMessage() {} func (x *ListResponseMessage_SingleSelectReply) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[170] + mi := &file_binary_proto_def_proto_msgTypes[173] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18620,7 +19010,7 @@ func (x *ListResponseMessage_SingleSelectReply) ProtoReflect() protoreflect.Mess // Deprecated: Use ListResponseMessage_SingleSelectReply.ProtoReflect.Descriptor instead. func (*ListResponseMessage_SingleSelectReply) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{11, 0} } func (x *ListResponseMessage_SingleSelectReply) GetSelectedRowId() string { @@ -18642,7 +19032,7 @@ type ListMessage_Section struct { func (x *ListMessage_Section) Reset() { *x = ListMessage_Section{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[171] + mi := &file_binary_proto_def_proto_msgTypes[174] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18655,7 +19045,7 @@ func (x *ListMessage_Section) String() string { func (*ListMessage_Section) ProtoMessage() {} func (x *ListMessage_Section) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[171] + mi := &file_binary_proto_def_proto_msgTypes[174] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18668,7 +19058,7 @@ func (x *ListMessage_Section) ProtoReflect() protoreflect.Message { // Deprecated: Use ListMessage_Section.ProtoReflect.Descriptor instead. func (*ListMessage_Section) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 0} } func (x *ListMessage_Section) GetTitle() string { @@ -18698,7 +19088,7 @@ type ListMessage_Row struct { func (x *ListMessage_Row) Reset() { *x = ListMessage_Row{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[172] + mi := &file_binary_proto_def_proto_msgTypes[175] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18711,7 +19101,7 @@ func (x *ListMessage_Row) String() string { func (*ListMessage_Row) ProtoMessage() {} func (x *ListMessage_Row) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[172] + mi := &file_binary_proto_def_proto_msgTypes[175] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18724,7 +19114,7 @@ func (x *ListMessage_Row) ProtoReflect() protoreflect.Message { // Deprecated: Use ListMessage_Row.ProtoReflect.Descriptor instead. func (*ListMessage_Row) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 1} } func (x *ListMessage_Row) GetTitle() string { @@ -18759,7 +19149,7 @@ type ListMessage_Product struct { func (x *ListMessage_Product) Reset() { *x = ListMessage_Product{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[173] + mi := &file_binary_proto_def_proto_msgTypes[176] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18772,7 +19162,7 @@ func (x *ListMessage_Product) String() string { func (*ListMessage_Product) ProtoMessage() {} func (x *ListMessage_Product) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[173] + mi := &file_binary_proto_def_proto_msgTypes[176] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18785,7 +19175,7 @@ func (x *ListMessage_Product) ProtoReflect() protoreflect.Message { // Deprecated: Use ListMessage_Product.ProtoReflect.Descriptor instead. func (*ListMessage_Product) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 2} } func (x *ListMessage_Product) GetProductId() string { @@ -18807,7 +19197,7 @@ type ListMessage_ProductSection struct { func (x *ListMessage_ProductSection) Reset() { *x = ListMessage_ProductSection{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[174] + mi := &file_binary_proto_def_proto_msgTypes[177] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18820,7 +19210,7 @@ func (x *ListMessage_ProductSection) String() string { func (*ListMessage_ProductSection) ProtoMessage() {} func (x *ListMessage_ProductSection) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[174] + mi := &file_binary_proto_def_proto_msgTypes[177] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18833,7 +19223,7 @@ func (x *ListMessage_ProductSection) ProtoReflect() protoreflect.Message { // Deprecated: Use ListMessage_ProductSection.ProtoReflect.Descriptor instead. func (*ListMessage_ProductSection) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 3} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 3} } func (x *ListMessage_ProductSection) GetTitle() string { @@ -18863,7 +19253,7 @@ type ListMessage_ProductListInfo struct { func (x *ListMessage_ProductListInfo) Reset() { *x = ListMessage_ProductListInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[175] + mi := &file_binary_proto_def_proto_msgTypes[178] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18876,7 +19266,7 @@ func (x *ListMessage_ProductListInfo) String() string { func (*ListMessage_ProductListInfo) ProtoMessage() {} func (x *ListMessage_ProductListInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[175] + mi := &file_binary_proto_def_proto_msgTypes[178] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18889,7 +19279,7 @@ func (x *ListMessage_ProductListInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use ListMessage_ProductListInfo.ProtoReflect.Descriptor instead. func (*ListMessage_ProductListInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 4} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 4} } func (x *ListMessage_ProductListInfo) GetProductSections() []*ListMessage_ProductSection { @@ -18925,7 +19315,7 @@ type ListMessage_ProductListHeaderImage struct { func (x *ListMessage_ProductListHeaderImage) Reset() { *x = ListMessage_ProductListHeaderImage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[176] + mi := &file_binary_proto_def_proto_msgTypes[179] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18938,7 +19328,7 @@ func (x *ListMessage_ProductListHeaderImage) String() string { func (*ListMessage_ProductListHeaderImage) ProtoMessage() {} func (x *ListMessage_ProductListHeaderImage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[176] + mi := &file_binary_proto_def_proto_msgTypes[179] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -18951,7 +19341,7 @@ func (x *ListMessage_ProductListHeaderImage) ProtoReflect() protoreflect.Message // Deprecated: Use ListMessage_ProductListHeaderImage.ProtoReflect.Descriptor instead. func (*ListMessage_ProductListHeaderImage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{13, 5} + return file_binary_proto_def_proto_rawDescGZIP(), []int{12, 5} } func (x *ListMessage_ProductListHeaderImage) GetProductId() string { @@ -18981,7 +19371,7 @@ type InteractiveResponseMessage_NativeFlowResponseMessage struct { func (x *InteractiveResponseMessage_NativeFlowResponseMessage) Reset() { *x = InteractiveResponseMessage_NativeFlowResponseMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[177] + mi := &file_binary_proto_def_proto_msgTypes[180] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -18994,7 +19384,7 @@ func (x *InteractiveResponseMessage_NativeFlowResponseMessage) String() string { func (*InteractiveResponseMessage_NativeFlowResponseMessage) ProtoMessage() {} func (x *InteractiveResponseMessage_NativeFlowResponseMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[177] + mi := &file_binary_proto_def_proto_msgTypes[180] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19007,7 +19397,7 @@ func (x *InteractiveResponseMessage_NativeFlowResponseMessage) ProtoReflect() pr // Deprecated: Use InteractiveResponseMessage_NativeFlowResponseMessage.ProtoReflect.Descriptor instead. func (*InteractiveResponseMessage_NativeFlowResponseMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{15, 0} } func (x *InteractiveResponseMessage_NativeFlowResponseMessage) GetName() string { @@ -19042,7 +19432,7 @@ type InteractiveResponseMessage_Body struct { func (x *InteractiveResponseMessage_Body) Reset() { *x = InteractiveResponseMessage_Body{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[178] + mi := &file_binary_proto_def_proto_msgTypes[181] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19055,7 +19445,7 @@ func (x *InteractiveResponseMessage_Body) String() string { func (*InteractiveResponseMessage_Body) ProtoMessage() {} func (x *InteractiveResponseMessage_Body) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[178] + mi := &file_binary_proto_def_proto_msgTypes[181] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19068,7 +19458,7 @@ func (x *InteractiveResponseMessage_Body) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveResponseMessage_Body.ProtoReflect.Descriptor instead. func (*InteractiveResponseMessage_Body) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{15, 1} } func (x *InteractiveResponseMessage_Body) GetText() string { @@ -19091,7 +19481,7 @@ type InteractiveMessage_ShopMessage struct { func (x *InteractiveMessage_ShopMessage) Reset() { *x = InteractiveMessage_ShopMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[179] + mi := &file_binary_proto_def_proto_msgTypes[182] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19104,7 +19494,7 @@ func (x *InteractiveMessage_ShopMessage) String() string { func (*InteractiveMessage_ShopMessage) ProtoMessage() {} func (x *InteractiveMessage_ShopMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[179] + mi := &file_binary_proto_def_proto_msgTypes[182] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19117,7 +19507,7 @@ func (x *InteractiveMessage_ShopMessage) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveMessage_ShopMessage.ProtoReflect.Descriptor instead. func (*InteractiveMessage_ShopMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 0} } func (x *InteractiveMessage_ShopMessage) GetId() string { @@ -19154,7 +19544,7 @@ type InteractiveMessage_NativeFlowMessage struct { func (x *InteractiveMessage_NativeFlowMessage) Reset() { *x = InteractiveMessage_NativeFlowMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[180] + mi := &file_binary_proto_def_proto_msgTypes[183] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19167,7 +19557,7 @@ func (x *InteractiveMessage_NativeFlowMessage) String() string { func (*InteractiveMessage_NativeFlowMessage) ProtoMessage() {} func (x *InteractiveMessage_NativeFlowMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[180] + mi := &file_binary_proto_def_proto_msgTypes[183] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19180,7 +19570,7 @@ func (x *InteractiveMessage_NativeFlowMessage) ProtoReflect() protoreflect.Messa // Deprecated: Use InteractiveMessage_NativeFlowMessage.ProtoReflect.Descriptor instead. func (*InteractiveMessage_NativeFlowMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 1} } func (x *InteractiveMessage_NativeFlowMessage) GetButtons() []*InteractiveMessage_NativeFlowMessage_NativeFlowButton { @@ -19224,7 +19614,7 @@ type InteractiveMessage_Header struct { func (x *InteractiveMessage_Header) Reset() { *x = InteractiveMessage_Header{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[181] + mi := &file_binary_proto_def_proto_msgTypes[184] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19237,7 +19627,7 @@ func (x *InteractiveMessage_Header) String() string { func (*InteractiveMessage_Header) ProtoMessage() {} func (x *InteractiveMessage_Header) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[181] + mi := &file_binary_proto_def_proto_msgTypes[184] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19250,7 +19640,7 @@ func (x *InteractiveMessage_Header) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveMessage_Header.ProtoReflect.Descriptor instead. func (*InteractiveMessage_Header) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 2} } func (x *InteractiveMessage_Header) GetTitle() string { @@ -19348,7 +19738,7 @@ type InteractiveMessage_Footer struct { func (x *InteractiveMessage_Footer) Reset() { *x = InteractiveMessage_Footer{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[182] + mi := &file_binary_proto_def_proto_msgTypes[185] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19361,7 +19751,7 @@ func (x *InteractiveMessage_Footer) String() string { func (*InteractiveMessage_Footer) ProtoMessage() {} func (x *InteractiveMessage_Footer) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[182] + mi := &file_binary_proto_def_proto_msgTypes[185] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19374,7 +19764,7 @@ func (x *InteractiveMessage_Footer) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveMessage_Footer.ProtoReflect.Descriptor instead. func (*InteractiveMessage_Footer) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 3} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 3} } func (x *InteractiveMessage_Footer) GetText() string { @@ -19397,7 +19787,7 @@ type InteractiveMessage_CollectionMessage struct { func (x *InteractiveMessage_CollectionMessage) Reset() { *x = InteractiveMessage_CollectionMessage{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[183] + mi := &file_binary_proto_def_proto_msgTypes[186] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19410,7 +19800,7 @@ func (x *InteractiveMessage_CollectionMessage) String() string { func (*InteractiveMessage_CollectionMessage) ProtoMessage() {} func (x *InteractiveMessage_CollectionMessage) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[183] + mi := &file_binary_proto_def_proto_msgTypes[186] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19423,7 +19813,7 @@ func (x *InteractiveMessage_CollectionMessage) ProtoReflect() protoreflect.Messa // Deprecated: Use InteractiveMessage_CollectionMessage.ProtoReflect.Descriptor instead. func (*InteractiveMessage_CollectionMessage) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 4} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 4} } func (x *InteractiveMessage_CollectionMessage) GetBizJid() string { @@ -19458,7 +19848,7 @@ type InteractiveMessage_Body struct { func (x *InteractiveMessage_Body) Reset() { *x = InteractiveMessage_Body{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[184] + mi := &file_binary_proto_def_proto_msgTypes[187] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19471,7 +19861,7 @@ func (x *InteractiveMessage_Body) String() string { func (*InteractiveMessage_Body) ProtoMessage() {} func (x *InteractiveMessage_Body) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[184] + mi := &file_binary_proto_def_proto_msgTypes[187] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19484,7 +19874,7 @@ func (x *InteractiveMessage_Body) ProtoReflect() protoreflect.Message { // Deprecated: Use InteractiveMessage_Body.ProtoReflect.Descriptor instead. func (*InteractiveMessage_Body) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 5} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 5} } func (x *InteractiveMessage_Body) GetText() string { @@ -19506,7 +19896,7 @@ type InteractiveMessage_NativeFlowMessage_NativeFlowButton struct { func (x *InteractiveMessage_NativeFlowMessage_NativeFlowButton) Reset() { *x = InteractiveMessage_NativeFlowMessage_NativeFlowButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[185] + mi := &file_binary_proto_def_proto_msgTypes[188] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19519,7 +19909,7 @@ func (x *InteractiveMessage_NativeFlowMessage_NativeFlowButton) String() string func (*InteractiveMessage_NativeFlowMessage_NativeFlowButton) ProtoMessage() {} func (x *InteractiveMessage_NativeFlowMessage_NativeFlowButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[185] + mi := &file_binary_proto_def_proto_msgTypes[188] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19532,7 +19922,7 @@ func (x *InteractiveMessage_NativeFlowMessage_NativeFlowButton) ProtoReflect() p // Deprecated: Use InteractiveMessage_NativeFlowMessage_NativeFlowButton.ProtoReflect.Descriptor instead. func (*InteractiveMessage_NativeFlowMessage_NativeFlowButton) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{17, 1, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{16, 1, 0} } func (x *InteractiveMessage_NativeFlowMessage_NativeFlowButton) GetName() string { @@ -19565,7 +19955,7 @@ type HighlyStructuredMessage_HSMLocalizableParameter struct { func (x *HighlyStructuredMessage_HSMLocalizableParameter) Reset() { *x = HighlyStructuredMessage_HSMLocalizableParameter{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[186] + mi := &file_binary_proto_def_proto_msgTypes[189] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19578,7 +19968,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter) String() string { func (*HighlyStructuredMessage_HSMLocalizableParameter) ProtoMessage() {} func (x *HighlyStructuredMessage_HSMLocalizableParameter) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[186] + mi := &file_binary_proto_def_proto_msgTypes[189] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19591,7 +19981,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter) ProtoReflect() protore // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter.ProtoReflect.Descriptor instead. func (*HighlyStructuredMessage_HSMLocalizableParameter) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0} } func (x *HighlyStructuredMessage_HSMLocalizableParameter) GetDefault() string { @@ -19655,7 +20045,7 @@ type HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime struct { func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) Reset() { *x = HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[187] + mi := &file_binary_proto_def_proto_msgTypes[190] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19668,7 +20058,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) String() s func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) ProtoMessage() {} func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[187] + mi := &file_binary_proto_def_proto_msgTypes[190] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19681,7 +20071,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) ProtoRefle // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime.ProtoReflect.Descriptor instead. func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0, 0} } func (m *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime) GetDatetimeOneof() isHighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_DatetimeOneof { @@ -19735,7 +20125,7 @@ type HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency struct { func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) Reset() { *x = HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[188] + mi := &file_binary_proto_def_proto_msgTypes[191] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19748,7 +20138,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) String() s func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) ProtoMessage() {} func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[188] + mi := &file_binary_proto_def_proto_msgTypes[191] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19761,7 +20151,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) ProtoRefle // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency.ProtoReflect.Descriptor instead. func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0, 1} } func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency) GetCurrencyCode() string { @@ -19789,7 +20179,7 @@ type HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnix func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch) Reset() { *x = HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[189] + mi := &file_binary_proto_def_proto_msgTypes[192] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19803,7 +20193,7 @@ func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUn } func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[189] + mi := &file_binary_proto_def_proto_msgTypes[192] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19816,7 +20206,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTime // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch.ProtoReflect.Descriptor instead. func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0, 0, 0} } func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch) GetTimestamp() int64 { @@ -19843,7 +20233,7 @@ type HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComp func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent) Reset() { *x = HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[190] + mi := &file_binary_proto_def_proto_msgTypes[193] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19857,7 +20247,7 @@ func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeCo } func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[190] + mi := &file_binary_proto_def_proto_msgTypes[193] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19870,7 +20260,7 @@ func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTime // Deprecated: Use HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent.ProtoReflect.Descriptor instead. func (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{21, 0, 0, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{20, 0, 0, 1} } func (x *HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent) GetDayOfWeek() HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_DayOfWeekType { @@ -19936,7 +20326,7 @@ type ButtonsMessage_Button struct { func (x *ButtonsMessage_Button) Reset() { *x = ButtonsMessage_Button{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[191] + mi := &file_binary_proto_def_proto_msgTypes[194] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -19949,7 +20339,7 @@ func (x *ButtonsMessage_Button) String() string { func (*ButtonsMessage_Button) ProtoMessage() {} func (x *ButtonsMessage_Button) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[191] + mi := &file_binary_proto_def_proto_msgTypes[194] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -19962,7 +20352,7 @@ func (x *ButtonsMessage_Button) ProtoReflect() protoreflect.Message { // Deprecated: Use ButtonsMessage_Button.ProtoReflect.Descriptor instead. func (*ButtonsMessage_Button) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{35, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{34, 0} } func (x *ButtonsMessage_Button) GetButtonId() string { @@ -20005,7 +20395,7 @@ type ButtonsMessage_Button_NativeFlowInfo struct { func (x *ButtonsMessage_Button_NativeFlowInfo) Reset() { *x = ButtonsMessage_Button_NativeFlowInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[192] + mi := &file_binary_proto_def_proto_msgTypes[195] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20018,7 +20408,7 @@ func (x *ButtonsMessage_Button_NativeFlowInfo) String() string { func (*ButtonsMessage_Button_NativeFlowInfo) ProtoMessage() {} func (x *ButtonsMessage_Button_NativeFlowInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[192] + mi := &file_binary_proto_def_proto_msgTypes[195] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20031,7 +20421,7 @@ func (x *ButtonsMessage_Button_NativeFlowInfo) ProtoReflect() protoreflect.Messa // Deprecated: Use ButtonsMessage_Button_NativeFlowInfo.ProtoReflect.Descriptor instead. func (*ButtonsMessage_Button_NativeFlowInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{35, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{34, 0, 0} } func (x *ButtonsMessage_Button_NativeFlowInfo) GetName() string { @@ -20059,7 +20449,7 @@ type ButtonsMessage_Button_ButtonText struct { func (x *ButtonsMessage_Button_ButtonText) Reset() { *x = ButtonsMessage_Button_ButtonText{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[193] + mi := &file_binary_proto_def_proto_msgTypes[196] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20072,7 +20462,7 @@ func (x *ButtonsMessage_Button_ButtonText) String() string { func (*ButtonsMessage_Button_ButtonText) ProtoMessage() {} func (x *ButtonsMessage_Button_ButtonText) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[193] + mi := &file_binary_proto_def_proto_msgTypes[196] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20085,7 +20475,7 @@ func (x *ButtonsMessage_Button_ButtonText) ProtoReflect() protoreflect.Message { // Deprecated: Use ButtonsMessage_Button_ButtonText.ProtoReflect.Descriptor instead. func (*ButtonsMessage_Button_ButtonText) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{35, 0, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{34, 0, 1} } func (x *ButtonsMessage_Button_ButtonText) GetDisplayText() string { @@ -20107,7 +20497,7 @@ type HydratedTemplateButton_HydratedURLButton struct { func (x *HydratedTemplateButton_HydratedURLButton) Reset() { *x = HydratedTemplateButton_HydratedURLButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[194] + mi := &file_binary_proto_def_proto_msgTypes[197] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20120,7 +20510,7 @@ func (x *HydratedTemplateButton_HydratedURLButton) String() string { func (*HydratedTemplateButton_HydratedURLButton) ProtoMessage() {} func (x *HydratedTemplateButton_HydratedURLButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[194] + mi := &file_binary_proto_def_proto_msgTypes[197] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20133,7 +20523,7 @@ func (x *HydratedTemplateButton_HydratedURLButton) ProtoReflect() protoreflect.M // Deprecated: Use HydratedTemplateButton_HydratedURLButton.ProtoReflect.Descriptor instead. func (*HydratedTemplateButton_HydratedURLButton) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{46, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{45, 0} } func (x *HydratedTemplateButton_HydratedURLButton) GetDisplayText() string { @@ -20162,7 +20552,7 @@ type HydratedTemplateButton_HydratedQuickReplyButton struct { func (x *HydratedTemplateButton_HydratedQuickReplyButton) Reset() { *x = HydratedTemplateButton_HydratedQuickReplyButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[195] + mi := &file_binary_proto_def_proto_msgTypes[198] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20175,7 +20565,7 @@ func (x *HydratedTemplateButton_HydratedQuickReplyButton) String() string { func (*HydratedTemplateButton_HydratedQuickReplyButton) ProtoMessage() {} func (x *HydratedTemplateButton_HydratedQuickReplyButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[195] + mi := &file_binary_proto_def_proto_msgTypes[198] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20188,7 +20578,7 @@ func (x *HydratedTemplateButton_HydratedQuickReplyButton) ProtoReflect() protore // Deprecated: Use HydratedTemplateButton_HydratedQuickReplyButton.ProtoReflect.Descriptor instead. func (*HydratedTemplateButton_HydratedQuickReplyButton) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{46, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{45, 1} } func (x *HydratedTemplateButton_HydratedQuickReplyButton) GetDisplayText() string { @@ -20217,7 +20607,7 @@ type HydratedTemplateButton_HydratedCallButton struct { func (x *HydratedTemplateButton_HydratedCallButton) Reset() { *x = HydratedTemplateButton_HydratedCallButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[196] + mi := &file_binary_proto_def_proto_msgTypes[199] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20230,7 +20620,7 @@ func (x *HydratedTemplateButton_HydratedCallButton) String() string { func (*HydratedTemplateButton_HydratedCallButton) ProtoMessage() {} func (x *HydratedTemplateButton_HydratedCallButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[196] + mi := &file_binary_proto_def_proto_msgTypes[199] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20243,7 +20633,7 @@ func (x *HydratedTemplateButton_HydratedCallButton) ProtoReflect() protoreflect. // Deprecated: Use HydratedTemplateButton_HydratedCallButton.ProtoReflect.Descriptor instead. func (*HydratedTemplateButton_HydratedCallButton) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{46, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{45, 2} } func (x *HydratedTemplateButton_HydratedCallButton) GetDisplayText() string { @@ -20260,6 +20650,61 @@ func (x *HydratedTemplateButton_HydratedCallButton) GetPhoneNumber() string { return "" } +type ContextInfo_UTMInfo struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + UtmSource *string `protobuf:"bytes,1,opt,name=utmSource" json:"utmSource,omitempty"` + UtmCampaign *string `protobuf:"bytes,2,opt,name=utmCampaign" json:"utmCampaign,omitempty"` +} + +func (x *ContextInfo_UTMInfo) Reset() { + *x = ContextInfo_UTMInfo{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[200] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *ContextInfo_UTMInfo) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*ContextInfo_UTMInfo) ProtoMessage() {} + +func (x *ContextInfo_UTMInfo) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[200] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use ContextInfo_UTMInfo.ProtoReflect.Descriptor instead. +func (*ContextInfo_UTMInfo) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 0} +} + +func (x *ContextInfo_UTMInfo) GetUtmSource() string { + if x != nil && x.UtmSource != nil { + return *x.UtmSource + } + return "" +} + +func (x *ContextInfo_UTMInfo) GetUtmCampaign() string { + if x != nil && x.UtmCampaign != nil { + return *x.UtmCampaign + } + return "" +} + type ContextInfo_ExternalAdReplyInfo struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -20283,7 +20728,7 @@ type ContextInfo_ExternalAdReplyInfo struct { func (x *ContextInfo_ExternalAdReplyInfo) Reset() { *x = ContextInfo_ExternalAdReplyInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[197] + mi := &file_binary_proto_def_proto_msgTypes[201] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20296,7 +20741,7 @@ func (x *ContextInfo_ExternalAdReplyInfo) String() string { func (*ContextInfo_ExternalAdReplyInfo) ProtoMessage() {} func (x *ContextInfo_ExternalAdReplyInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[197] + mi := &file_binary_proto_def_proto_msgTypes[201] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20309,7 +20754,7 @@ func (x *ContextInfo_ExternalAdReplyInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use ContextInfo_ExternalAdReplyInfo.ProtoReflect.Descriptor instead. func (*ContextInfo_ExternalAdReplyInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 1} } func (x *ContextInfo_ExternalAdReplyInfo) GetTitle() string { @@ -20417,7 +20862,7 @@ type ContextInfo_AdReplyInfo struct { func (x *ContextInfo_AdReplyInfo) Reset() { *x = ContextInfo_AdReplyInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[198] + mi := &file_binary_proto_def_proto_msgTypes[202] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20430,7 +20875,7 @@ func (x *ContextInfo_AdReplyInfo) String() string { func (*ContextInfo_AdReplyInfo) ProtoMessage() {} func (x *ContextInfo_AdReplyInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[198] + mi := &file_binary_proto_def_proto_msgTypes[202] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20443,7 +20888,7 @@ func (x *ContextInfo_AdReplyInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use ContextInfo_AdReplyInfo.ProtoReflect.Descriptor instead. func (*ContextInfo_AdReplyInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{49, 2} } func (x *ContextInfo_AdReplyInfo) GetAdvertiserName() string { @@ -20486,7 +20931,7 @@ type TemplateButton_URLButton struct { func (x *TemplateButton_URLButton) Reset() { *x = TemplateButton_URLButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[199] + mi := &file_binary_proto_def_proto_msgTypes[203] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20499,7 +20944,7 @@ func (x *TemplateButton_URLButton) String() string { func (*TemplateButton_URLButton) ProtoMessage() {} func (x *TemplateButton_URLButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[199] + mi := &file_binary_proto_def_proto_msgTypes[203] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20541,7 +20986,7 @@ type TemplateButton_QuickReplyButton struct { func (x *TemplateButton_QuickReplyButton) Reset() { *x = TemplateButton_QuickReplyButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[200] + mi := &file_binary_proto_def_proto_msgTypes[204] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20554,7 +20999,7 @@ func (x *TemplateButton_QuickReplyButton) String() string { func (*TemplateButton_QuickReplyButton) ProtoMessage() {} func (x *TemplateButton_QuickReplyButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[200] + mi := &file_binary_proto_def_proto_msgTypes[204] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20596,7 +21041,7 @@ type TemplateButton_CallButton struct { func (x *TemplateButton_CallButton) Reset() { *x = TemplateButton_CallButton{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[201] + mi := &file_binary_proto_def_proto_msgTypes[205] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20609,7 +21054,7 @@ func (x *TemplateButton_CallButton) String() string { func (*TemplateButton_CallButton) ProtoMessage() {} func (x *TemplateButton_CallButton) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[201] + mi := &file_binary_proto_def_proto_msgTypes[205] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20654,7 +21099,7 @@ type PaymentBackground_MediaData struct { func (x *PaymentBackground_MediaData) Reset() { *x = PaymentBackground_MediaData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[202] + mi := &file_binary_proto_def_proto_msgTypes[206] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20667,7 +21112,7 @@ func (x *PaymentBackground_MediaData) String() string { func (*PaymentBackground_MediaData) ProtoMessage() {} func (x *PaymentBackground_MediaData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[202] + mi := &file_binary_proto_def_proto_msgTypes[206] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20740,7 +21185,7 @@ type TemplateMessage_HydratedFourRowTemplate struct { func (x *TemplateMessage_HydratedFourRowTemplate) Reset() { *x = TemplateMessage_HydratedFourRowTemplate{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[203] + mi := &file_binary_proto_def_proto_msgTypes[207] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20753,7 +21198,7 @@ func (x *TemplateMessage_HydratedFourRowTemplate) String() string { func (*TemplateMessage_HydratedFourRowTemplate) ProtoMessage() {} func (x *TemplateMessage_HydratedFourRowTemplate) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[203] + mi := &file_binary_proto_def_proto_msgTypes[207] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -20899,7 +21344,7 @@ type TemplateMessage_FourRowTemplate struct { func (x *TemplateMessage_FourRowTemplate) Reset() { *x = TemplateMessage_FourRowTemplate{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[204] + mi := &file_binary_proto_def_proto_msgTypes[208] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -20912,7 +21357,7 @@ func (x *TemplateMessage_FourRowTemplate) String() string { func (*TemplateMessage_FourRowTemplate) ProtoMessage() {} func (x *TemplateMessage_FourRowTemplate) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[204] + mi := &file_binary_proto_def_proto_msgTypes[208] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21047,7 +21492,7 @@ type ProductMessage_ProductSnapshot struct { func (x *ProductMessage_ProductSnapshot) Reset() { *x = ProductMessage_ProductSnapshot{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[205] + mi := &file_binary_proto_def_proto_msgTypes[209] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21060,7 +21505,7 @@ func (x *ProductMessage_ProductSnapshot) String() string { func (*ProductMessage_ProductSnapshot) ProtoMessage() {} func (x *ProductMessage_ProductSnapshot) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[205] + mi := &file_binary_proto_def_proto_msgTypes[209] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21073,7 +21518,7 @@ func (x *ProductMessage_ProductSnapshot) ProtoReflect() protoreflect.Message { // Deprecated: Use ProductMessage_ProductSnapshot.ProtoReflect.Descriptor instead. func (*ProductMessage_ProductSnapshot) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{68, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{70, 0} } func (x *ProductMessage_ProductSnapshot) GetProductImage() *ImageMessage { @@ -21166,7 +21611,7 @@ type ProductMessage_CatalogSnapshot struct { func (x *ProductMessage_CatalogSnapshot) Reset() { *x = ProductMessage_CatalogSnapshot{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[206] + mi := &file_binary_proto_def_proto_msgTypes[210] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21179,7 +21624,7 @@ func (x *ProductMessage_CatalogSnapshot) String() string { func (*ProductMessage_CatalogSnapshot) ProtoMessage() {} func (x *ProductMessage_CatalogSnapshot) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[206] + mi := &file_binary_proto_def_proto_msgTypes[210] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21192,7 +21637,7 @@ func (x *ProductMessage_CatalogSnapshot) ProtoReflect() protoreflect.Message { // Deprecated: Use ProductMessage_CatalogSnapshot.ProtoReflect.Descriptor instead. func (*ProductMessage_CatalogSnapshot) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{68, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{70, 1} } func (x *ProductMessage_CatalogSnapshot) GetCatalogImage() *ImageMessage { @@ -21227,7 +21672,7 @@ type PollCreationMessage_Option struct { func (x *PollCreationMessage_Option) Reset() { *x = PollCreationMessage_Option{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[207] + mi := &file_binary_proto_def_proto_msgTypes[211] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21240,7 +21685,7 @@ func (x *PollCreationMessage_Option) String() string { func (*PollCreationMessage_Option) ProtoMessage() {} func (x *PollCreationMessage_Option) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[207] + mi := &file_binary_proto_def_proto_msgTypes[211] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21253,7 +21698,7 @@ func (x *PollCreationMessage_Option) ProtoReflect() protoreflect.Message { // Deprecated: Use PollCreationMessage_Option.ProtoReflect.Descriptor instead. func (*PollCreationMessage_Option) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{73, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{75, 0} } func (x *PollCreationMessage_Option) GetOptionName() string { @@ -21263,6 +21708,165 @@ func (x *PollCreationMessage_Option) GetOptionName() string { return "" } +type PeerDataOperationRequestResponseMessage_PeerDataOperationResult struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + MediaUploadResult *MediaRetryNotification_ResultType `protobuf:"varint,1,opt,name=mediaUploadResult,enum=proto.MediaRetryNotification_ResultType" json:"mediaUploadResult,omitempty"` + StickerMessage *StickerMessage `protobuf:"bytes,2,opt,name=stickerMessage" json:"stickerMessage,omitempty"` + LinkPreviewResponse *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse `protobuf:"bytes,3,opt,name=linkPreviewResponse" json:"linkPreviewResponse,omitempty"` +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) Reset() { + *x = PeerDataOperationRequestResponseMessage_PeerDataOperationResult{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[212] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult) ProtoMessage() {} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[212] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use PeerDataOperationRequestResponseMessage_PeerDataOperationResult.ProtoReflect.Descriptor instead. +func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{77, 0} +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) GetMediaUploadResult() MediaRetryNotification_ResultType { + if x != nil && x.MediaUploadResult != nil { + return *x.MediaUploadResult + } + return MediaRetryNotification_GENERAL_ERROR +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) GetStickerMessage() *StickerMessage { + if x != nil { + return x.StickerMessage + } + return nil +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult) GetLinkPreviewResponse() *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse { + if x != nil { + return x.LinkPreviewResponse + } + return nil +} + +type PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse struct { + state protoimpl.MessageState + sizeCache protoimpl.SizeCache + unknownFields protoimpl.UnknownFields + + Url *string `protobuf:"bytes,1,opt,name=url" json:"url,omitempty"` + Title *string `protobuf:"bytes,2,opt,name=title" json:"title,omitempty"` + Description *string `protobuf:"bytes,3,opt,name=description" json:"description,omitempty"` + ThumbData []byte `protobuf:"bytes,4,opt,name=thumbData" json:"thumbData,omitempty"` + CanonicalUrl *string `protobuf:"bytes,5,opt,name=canonicalUrl" json:"canonicalUrl,omitempty"` + MatchText *string `protobuf:"bytes,6,opt,name=matchText" json:"matchText,omitempty"` + PreviewType *string `protobuf:"bytes,7,opt,name=previewType" json:"previewType,omitempty"` +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) Reset() { + *x = PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse{} + if protoimpl.UnsafeEnabled { + mi := &file_binary_proto_def_proto_msgTypes[213] + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + ms.StoreMessageInfo(mi) + } +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) String() string { + return protoimpl.X.MessageStringOf(x) +} + +func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) ProtoMessage() { +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) ProtoReflect() protoreflect.Message { + mi := &file_binary_proto_def_proto_msgTypes[213] + if protoimpl.UnsafeEnabled && x != nil { + ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) + if ms.LoadMessageInfo() == nil { + ms.StoreMessageInfo(mi) + } + return ms + } + return mi.MessageOf(x) +} + +// Deprecated: Use PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse.ProtoReflect.Descriptor instead. +func (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) Descriptor() ([]byte, []int) { + return file_binary_proto_def_proto_rawDescGZIP(), []int{77, 0, 0} +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetUrl() string { + if x != nil && x.Url != nil { + return *x.Url + } + return "" +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetTitle() string { + if x != nil && x.Title != nil { + return *x.Title + } + return "" +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetDescription() string { + if x != nil && x.Description != nil { + return *x.Description + } + return "" +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetThumbData() []byte { + if x != nil { + return x.ThumbData + } + return nil +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetCanonicalUrl() string { + if x != nil && x.CanonicalUrl != nil { + return *x.CanonicalUrl + } + return "" +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetMatchText() string { + if x != nil && x.MatchText != nil { + return *x.MatchText + } + return "" +} + +func (x *PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse) GetPreviewType() string { + if x != nil && x.PreviewType != nil { + return *x.PreviewType + } + return "" +} + type MsgOpaqueData_PollOption struct { state protoimpl.MessageState sizeCache protoimpl.SizeCache @@ -21274,7 +21878,7 @@ type MsgOpaqueData_PollOption struct { func (x *MsgOpaqueData_PollOption) Reset() { *x = MsgOpaqueData_PollOption{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[208] + mi := &file_binary_proto_def_proto_msgTypes[214] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21287,7 +21891,7 @@ func (x *MsgOpaqueData_PollOption) String() string { func (*MsgOpaqueData_PollOption) ProtoMessage() {} func (x *MsgOpaqueData_PollOption) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[208] + mi := &file_binary_proto_def_proto_msgTypes[214] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21300,7 +21904,7 @@ func (x *MsgOpaqueData_PollOption) ProtoReflect() protoreflect.Message { // Deprecated: Use MsgOpaqueData_PollOption.ProtoReflect.Descriptor instead. func (*MsgOpaqueData_PollOption) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{88, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{92, 0} } func (x *MsgOpaqueData_PollOption) GetName() string { @@ -21325,7 +21929,7 @@ type VerifiedNameCertificate_Details struct { func (x *VerifiedNameCertificate_Details) Reset() { *x = VerifiedNameCertificate_Details{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[209] + mi := &file_binary_proto_def_proto_msgTypes[215] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21338,7 +21942,7 @@ func (x *VerifiedNameCertificate_Details) String() string { func (*VerifiedNameCertificate_Details) ProtoMessage() {} func (x *VerifiedNameCertificate_Details) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[209] + mi := &file_binary_proto_def_proto_msgTypes[215] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21351,7 +21955,7 @@ func (x *VerifiedNameCertificate_Details) ProtoReflect() protoreflect.Message { // Deprecated: Use VerifiedNameCertificate_Details.ProtoReflect.Descriptor instead. func (*VerifiedNameCertificate_Details) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{139, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{143, 0} } func (x *VerifiedNameCertificate_Details) GetSerial() uint64 { @@ -21403,7 +22007,7 @@ type ClientPayload_WebInfo struct { func (x *ClientPayload_WebInfo) Reset() { *x = ClientPayload_WebInfo{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[210] + mi := &file_binary_proto_def_proto_msgTypes[216] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21416,7 +22020,7 @@ func (x *ClientPayload_WebInfo) String() string { func (*ClientPayload_WebInfo) ProtoMessage() {} func (x *ClientPayload_WebInfo) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[210] + mi := &file_binary_proto_def_proto_msgTypes[216] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21429,7 +22033,7 @@ func (x *ClientPayload_WebInfo) ProtoReflect() protoreflect.Message { // Deprecated: Use ClientPayload_WebInfo.ProtoReflect.Descriptor instead. func (*ClientPayload_WebInfo) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 0} } func (x *ClientPayload_WebInfo) GetRefToken() string { @@ -21483,7 +22087,7 @@ type ClientPayload_UserAgent struct { func (x *ClientPayload_UserAgent) Reset() { *x = ClientPayload_UserAgent{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[211] + mi := &file_binary_proto_def_proto_msgTypes[217] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21496,7 +22100,7 @@ func (x *ClientPayload_UserAgent) String() string { func (*ClientPayload_UserAgent) ProtoMessage() {} func (x *ClientPayload_UserAgent) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[211] + mi := &file_binary_proto_def_proto_msgTypes[217] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21509,7 +22113,7 @@ func (x *ClientPayload_UserAgent) ProtoReflect() protoreflect.Message { // Deprecated: Use ClientPayload_UserAgent.ProtoReflect.Descriptor instead. func (*ClientPayload_UserAgent) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 1} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 1} } func (x *ClientPayload_UserAgent) GetPlatform() ClientPayload_UserAgent_Platform { @@ -21621,7 +22225,7 @@ type ClientPayload_DevicePairingRegistrationData struct { func (x *ClientPayload_DevicePairingRegistrationData) Reset() { *x = ClientPayload_DevicePairingRegistrationData{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[212] + mi := &file_binary_proto_def_proto_msgTypes[218] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21634,7 +22238,7 @@ func (x *ClientPayload_DevicePairingRegistrationData) String() string { func (*ClientPayload_DevicePairingRegistrationData) ProtoMessage() {} func (x *ClientPayload_DevicePairingRegistrationData) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[212] + mi := &file_binary_proto_def_proto_msgTypes[218] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21647,7 +22251,7 @@ func (x *ClientPayload_DevicePairingRegistrationData) ProtoReflect() protoreflec // Deprecated: Use ClientPayload_DevicePairingRegistrationData.ProtoReflect.Descriptor instead. func (*ClientPayload_DevicePairingRegistrationData) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 2} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 2} } func (x *ClientPayload_DevicePairingRegistrationData) GetERegid() []byte { @@ -21718,7 +22322,7 @@ type ClientPayload_DNSSource struct { func (x *ClientPayload_DNSSource) Reset() { *x = ClientPayload_DNSSource{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[213] + mi := &file_binary_proto_def_proto_msgTypes[219] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21731,7 +22335,7 @@ func (x *ClientPayload_DNSSource) String() string { func (*ClientPayload_DNSSource) ProtoMessage() {} func (x *ClientPayload_DNSSource) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[213] + mi := &file_binary_proto_def_proto_msgTypes[219] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21744,7 +22348,7 @@ func (x *ClientPayload_DNSSource) ProtoReflect() protoreflect.Message { // Deprecated: Use ClientPayload_DNSSource.ProtoReflect.Descriptor instead. func (*ClientPayload_DNSSource) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 3} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 3} } func (x *ClientPayload_DNSSource) GetDnsMethod() ClientPayload_DNSSource_DNSResolutionMethod { @@ -21782,7 +22386,7 @@ type ClientPayload_WebInfo_WebdPayload struct { func (x *ClientPayload_WebInfo_WebdPayload) Reset() { *x = ClientPayload_WebInfo_WebdPayload{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[214] + mi := &file_binary_proto_def_proto_msgTypes[220] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21795,7 +22399,7 @@ func (x *ClientPayload_WebInfo_WebdPayload) String() string { func (*ClientPayload_WebInfo_WebdPayload) ProtoMessage() {} func (x *ClientPayload_WebInfo_WebdPayload) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[214] + mi := &file_binary_proto_def_proto_msgTypes[220] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21808,7 +22412,7 @@ func (x *ClientPayload_WebInfo_WebdPayload) ProtoReflect() protoreflect.Message // Deprecated: Use ClientPayload_WebInfo_WebdPayload.ProtoReflect.Descriptor instead. func (*ClientPayload_WebInfo_WebdPayload) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 0, 0} } func (x *ClientPayload_WebInfo_WebdPayload) GetUsesParticipantInKey() bool { @@ -21903,7 +22507,7 @@ type ClientPayload_UserAgent_AppVersion struct { func (x *ClientPayload_UserAgent_AppVersion) Reset() { *x = ClientPayload_UserAgent_AppVersion{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[215] + mi := &file_binary_proto_def_proto_msgTypes[221] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21916,7 +22520,7 @@ func (x *ClientPayload_UserAgent_AppVersion) String() string { func (*ClientPayload_UserAgent_AppVersion) ProtoMessage() {} func (x *ClientPayload_UserAgent_AppVersion) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[215] + mi := &file_binary_proto_def_proto_msgTypes[221] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -21929,7 +22533,7 @@ func (x *ClientPayload_UserAgent_AppVersion) ProtoReflect() protoreflect.Message // Deprecated: Use ClientPayload_UserAgent_AppVersion.ProtoReflect.Descriptor instead. func (*ClientPayload_UserAgent_AppVersion) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{148, 1, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{152, 1, 0} } func (x *ClientPayload_UserAgent_AppVersion) GetPrimary() uint32 { @@ -21982,7 +22586,7 @@ type NoiseCertificate_Details struct { func (x *NoiseCertificate_Details) Reset() { *x = NoiseCertificate_Details{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[216] + mi := &file_binary_proto_def_proto_msgTypes[222] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -21995,7 +22599,7 @@ func (x *NoiseCertificate_Details) String() string { func (*NoiseCertificate_Details) ProtoMessage() {} func (x *NoiseCertificate_Details) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[216] + mi := &file_binary_proto_def_proto_msgTypes[222] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -22008,7 +22612,7 @@ func (x *NoiseCertificate_Details) ProtoReflect() protoreflect.Message { // Deprecated: Use NoiseCertificate_Details.ProtoReflect.Descriptor instead. func (*NoiseCertificate_Details) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{162, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{166, 0} } func (x *NoiseCertificate_Details) GetSerial() uint32 { @@ -22058,7 +22662,7 @@ type CertChain_NoiseCertificate struct { func (x *CertChain_NoiseCertificate) Reset() { *x = CertChain_NoiseCertificate{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[217] + mi := &file_binary_proto_def_proto_msgTypes[223] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -22071,7 +22675,7 @@ func (x *CertChain_NoiseCertificate) String() string { func (*CertChain_NoiseCertificate) ProtoMessage() {} func (x *CertChain_NoiseCertificate) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[217] + mi := &file_binary_proto_def_proto_msgTypes[223] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -22084,7 +22688,7 @@ func (x *CertChain_NoiseCertificate) ProtoReflect() protoreflect.Message { // Deprecated: Use CertChain_NoiseCertificate.ProtoReflect.Descriptor instead. func (*CertChain_NoiseCertificate) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{163, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{167, 0} } func (x *CertChain_NoiseCertificate) GetDetails() []byte { @@ -22116,7 +22720,7 @@ type CertChain_NoiseCertificate_Details struct { func (x *CertChain_NoiseCertificate_Details) Reset() { *x = CertChain_NoiseCertificate_Details{} if protoimpl.UnsafeEnabled { - mi := &file_binary_proto_def_proto_msgTypes[218] + mi := &file_binary_proto_def_proto_msgTypes[224] ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) ms.StoreMessageInfo(mi) } @@ -22129,7 +22733,7 @@ func (x *CertChain_NoiseCertificate_Details) String() string { func (*CertChain_NoiseCertificate_Details) ProtoMessage() {} func (x *CertChain_NoiseCertificate_Details) ProtoReflect() protoreflect.Message { - mi := &file_binary_proto_def_proto_msgTypes[218] + mi := &file_binary_proto_def_proto_msgTypes[224] if protoimpl.UnsafeEnabled && x != nil { ms := protoimpl.X.MessageStateOf(protoimpl.Pointer(x)) if ms.LoadMessageInfo() == nil { @@ -22142,7 +22746,7 @@ func (x *CertChain_NoiseCertificate_Details) ProtoReflect() protoreflect.Message // Deprecated: Use CertChain_NoiseCertificate_Details.ProtoReflect.Descriptor instead. func (*CertChain_NoiseCertificate_Details) Descriptor() ([]byte, []int) { - return file_binary_proto_def_proto_rawDescGZIP(), []int{163, 0, 0} + return file_binary_proto_def_proto_rawDescGZIP(), []int{167, 0, 0} } func (x *CertChain_NoiseCertificate_Details) GetSerial() uint32 { @@ -22197,11 +22801,11 @@ func file_binary_proto_def_proto_rawDescGZIP() []byte { return file_binary_proto_def_proto_rawDescData } -var file_binary_proto_def_proto_enumTypes = make([]protoimpl.EnumInfo, 54) -var file_binary_proto_def_proto_msgTypes = make([]protoimpl.MessageInfo, 219) +var file_binary_proto_def_proto_enumTypes = make([]protoimpl.EnumInfo, 56) +var file_binary_proto_def_proto_msgTypes = make([]protoimpl.MessageInfo, 225) var file_binary_proto_def_proto_goTypes = []interface{}{ - (PeerDataOperationRequestType)(0), // 0: proto.PeerDataOperationRequestType - (KeepType)(0), // 1: proto.KeepType + (KeepType)(0), // 0: proto.KeepType + (PeerDataOperationRequestType)(0), // 1: proto.PeerDataOperationRequestType (MediaVisibility)(0), // 2: proto.MediaVisibility (DeviceProps_PlatformType)(0), // 3: proto.DeviceProps.PlatformType (PaymentInviteMessage_ServiceType)(0), // 4: proto.PaymentInviteMessage.ServiceType @@ -22214,675 +22818,696 @@ var file_binary_proto_def_proto_goTypes = []interface{}{ (HistorySyncNotification_HistorySyncType)(0), // 11: proto.HistorySyncNotification.HistorySyncType (HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_DayOfWeekType)(0), // 12: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.DayOfWeekType (HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent_CalendarType)(0), // 13: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.CalendarType - (GroupInviteMessage_GroupType)(0), // 14: proto.GroupInviteMessage.GroupType - (ExtendedTextMessage_PreviewType)(0), // 15: proto.ExtendedTextMessage.PreviewType - (ExtendedTextMessage_InviteLinkGroupType)(0), // 16: proto.ExtendedTextMessage.InviteLinkGroupType - (ExtendedTextMessage_FontType)(0), // 17: proto.ExtendedTextMessage.FontType - (ButtonsResponseMessage_Type)(0), // 18: proto.ButtonsResponseMessage.Type - (ButtonsMessage_HeaderType)(0), // 19: proto.ButtonsMessage.HeaderType - (ButtonsMessage_Button_Type)(0), // 20: proto.ButtonsMessage.Button.Type - (DisappearingMode_Initiator)(0), // 21: proto.DisappearingMode.Initiator - (ContextInfo_ExternalAdReplyInfo_MediaType)(0), // 22: proto.ContextInfo.ExternalAdReplyInfo.MediaType - (ContextInfo_AdReplyInfo_MediaType)(0), // 23: proto.ContextInfo.AdReplyInfo.MediaType - (PaymentBackground_Type)(0), // 24: proto.PaymentBackground.Type - (VideoMessage_Attribution)(0), // 25: proto.VideoMessage.Attribution - (ProtocolMessage_Type)(0), // 26: proto.ProtocolMessage.Type - (PastParticipant_LeaveReason)(0), // 27: proto.PastParticipant.LeaveReason - (HistorySync_HistorySyncType)(0), // 28: proto.HistorySync.HistorySyncType - (GroupParticipant_Rank)(0), // 29: proto.GroupParticipant.Rank - (Conversation_EndOfHistoryTransferType)(0), // 30: proto.Conversation.EndOfHistoryTransferType - (MediaRetryNotification_ResultType)(0), // 31: proto.MediaRetryNotification.ResultType - (SyncdMutation_SyncdOperation)(0), // 32: proto.SyncdMutation.SyncdOperation - (BizIdentityInfo_VerifiedLevelValue)(0), // 33: proto.BizIdentityInfo.VerifiedLevelValue - (BizIdentityInfo_HostStorageType)(0), // 34: proto.BizIdentityInfo.HostStorageType - (BizIdentityInfo_ActualActorsType)(0), // 35: proto.BizIdentityInfo.ActualActorsType - (BizAccountLinkInfo_HostStorageType)(0), // 36: proto.BizAccountLinkInfo.HostStorageType - (BizAccountLinkInfo_AccountType)(0), // 37: proto.BizAccountLinkInfo.AccountType - (ClientPayload_Product)(0), // 38: proto.ClientPayload.Product - (ClientPayload_IOSAppExtension)(0), // 39: proto.ClientPayload.IOSAppExtension - (ClientPayload_ConnectType)(0), // 40: proto.ClientPayload.ConnectType - (ClientPayload_ConnectReason)(0), // 41: proto.ClientPayload.ConnectReason - (ClientPayload_BizMarketSegment)(0), // 42: proto.ClientPayload.BizMarketSegment - (ClientPayload_WebInfo_WebSubPlatform)(0), // 43: proto.ClientPayload.WebInfo.WebSubPlatform - (ClientPayload_UserAgent_ReleaseChannel)(0), // 44: proto.ClientPayload.UserAgent.ReleaseChannel - (ClientPayload_UserAgent_Platform)(0), // 45: proto.ClientPayload.UserAgent.Platform - (ClientPayload_DNSSource_DNSResolutionMethod)(0), // 46: proto.ClientPayload.DNSSource.DNSResolutionMethod - (WebMessageInfo_StubType)(0), // 47: proto.WebMessageInfo.StubType - (WebMessageInfo_Status)(0), // 48: proto.WebMessageInfo.Status - (WebMessageInfo_BizPrivacyStatus)(0), // 49: proto.WebMessageInfo.BizPrivacyStatus - (WebFeatures_Flag)(0), // 50: proto.WebFeatures.Flag - (PaymentInfo_TxnStatus)(0), // 51: proto.PaymentInfo.TxnStatus - (PaymentInfo_Status)(0), // 52: proto.PaymentInfo.Status - (PaymentInfo_Currency)(0), // 53: proto.PaymentInfo.Currency - (*ADVSignedKeyIndexList)(nil), // 54: proto.ADVSignedKeyIndexList - (*ADVSignedDeviceIdentity)(nil), // 55: proto.ADVSignedDeviceIdentity - (*ADVSignedDeviceIdentityHMAC)(nil), // 56: proto.ADVSignedDeviceIdentityHMAC - (*ADVKeyIndexList)(nil), // 57: proto.ADVKeyIndexList - (*ADVDeviceIdentity)(nil), // 58: proto.ADVDeviceIdentity - (*DeviceProps)(nil), // 59: proto.DeviceProps - (*PeerDataOperationRequestResponseMessage)(nil), // 60: proto.PeerDataOperationRequestResponseMessage - (*PeerDataOperationRequestMessage)(nil), // 61: proto.PeerDataOperationRequestMessage - (*PaymentInviteMessage)(nil), // 62: proto.PaymentInviteMessage - (*OrderMessage)(nil), // 63: proto.OrderMessage - (*LocationMessage)(nil), // 64: proto.LocationMessage - (*LiveLocationMessage)(nil), // 65: proto.LiveLocationMessage - (*ListResponseMessage)(nil), // 66: proto.ListResponseMessage - (*ListMessage)(nil), // 67: proto.ListMessage - (*KeepInChatMessage)(nil), // 68: proto.KeepInChatMessage - (*InvoiceMessage)(nil), // 69: proto.InvoiceMessage - (*InteractiveResponseMessage)(nil), // 70: proto.InteractiveResponseMessage - (*InteractiveMessage)(nil), // 71: proto.InteractiveMessage - (*InitialSecurityNotificationSettingSync)(nil), // 72: proto.InitialSecurityNotificationSettingSync - (*ImageMessage)(nil), // 73: proto.ImageMessage - (*HistorySyncNotification)(nil), // 74: proto.HistorySyncNotification - (*HighlyStructuredMessage)(nil), // 75: proto.HighlyStructuredMessage - (*GroupInviteMessage)(nil), // 76: proto.GroupInviteMessage - (*FutureProofMessage)(nil), // 77: proto.FutureProofMessage - (*ExtendedTextMessage)(nil), // 78: proto.ExtendedTextMessage - (*EncReactionMessage)(nil), // 79: proto.EncReactionMessage - (*DocumentMessage)(nil), // 80: proto.DocumentMessage - (*DeviceSentMessage)(nil), // 81: proto.DeviceSentMessage - (*DeclinePaymentRequestMessage)(nil), // 82: proto.DeclinePaymentRequestMessage - (*ContactsArrayMessage)(nil), // 83: proto.ContactsArrayMessage - (*ContactMessage)(nil), // 84: proto.ContactMessage - (*Chat)(nil), // 85: proto.Chat - (*CancelPaymentRequestMessage)(nil), // 86: proto.CancelPaymentRequestMessage - (*Call)(nil), // 87: proto.Call - (*ButtonsResponseMessage)(nil), // 88: proto.ButtonsResponseMessage - (*ButtonsMessage)(nil), // 89: proto.ButtonsMessage - (*AudioMessage)(nil), // 90: proto.AudioMessage - (*AppStateSyncKey)(nil), // 91: proto.AppStateSyncKey - (*AppStateSyncKeyShare)(nil), // 92: proto.AppStateSyncKeyShare - (*AppStateSyncKeyRequest)(nil), // 93: proto.AppStateSyncKeyRequest - (*AppStateSyncKeyId)(nil), // 94: proto.AppStateSyncKeyId - (*AppStateSyncKeyFingerprint)(nil), // 95: proto.AppStateSyncKeyFingerprint - (*AppStateSyncKeyData)(nil), // 96: proto.AppStateSyncKeyData - (*AppStateFatalExceptionNotification)(nil), // 97: proto.AppStateFatalExceptionNotification - (*Location)(nil), // 98: proto.Location - (*InteractiveAnnotation)(nil), // 99: proto.InteractiveAnnotation - (*HydratedTemplateButton)(nil), // 100: proto.HydratedTemplateButton - (*DisappearingMode)(nil), // 101: proto.DisappearingMode - (*DeviceListMetadata)(nil), // 102: proto.DeviceListMetadata - (*ContextInfo)(nil), // 103: proto.ContextInfo - (*ActionLink)(nil), // 104: proto.ActionLink - (*TemplateButton)(nil), // 105: proto.TemplateButton - (*Point)(nil), // 106: proto.Point - (*PaymentBackground)(nil), // 107: proto.PaymentBackground - (*Money)(nil), // 108: proto.Money - (*Message)(nil), // 109: proto.Message - (*MessageContextInfo)(nil), // 110: proto.MessageContextInfo - (*VideoMessage)(nil), // 111: proto.VideoMessage - (*TemplateMessage)(nil), // 112: proto.TemplateMessage - (*TemplateButtonReplyMessage)(nil), // 113: proto.TemplateButtonReplyMessage - (*StickerSyncRMRMessage)(nil), // 114: proto.StickerSyncRMRMessage - (*StickerMessage)(nil), // 115: proto.StickerMessage - (*SenderKeyDistributionMessage)(nil), // 116: proto.SenderKeyDistributionMessage - (*SendPaymentMessage)(nil), // 117: proto.SendPaymentMessage - (*RequestPhoneNumberMessage)(nil), // 118: proto.RequestPhoneNumberMessage - (*RequestPaymentMessage)(nil), // 119: proto.RequestPaymentMessage - (*ReactionMessage)(nil), // 120: proto.ReactionMessage - (*ProtocolMessage)(nil), // 121: proto.ProtocolMessage - (*ProductMessage)(nil), // 122: proto.ProductMessage - (*PollVoteMessage)(nil), // 123: proto.PollVoteMessage - (*PollUpdateMessage)(nil), // 124: proto.PollUpdateMessage - (*PollUpdateMessageMetadata)(nil), // 125: proto.PollUpdateMessageMetadata - (*PollEncValue)(nil), // 126: proto.PollEncValue - (*PollCreationMessage)(nil), // 127: proto.PollCreationMessage - (*EphemeralSetting)(nil), // 128: proto.EphemeralSetting - (*WallpaperSettings)(nil), // 129: proto.WallpaperSettings - (*StickerMetadata)(nil), // 130: proto.StickerMetadata - (*Pushname)(nil), // 131: proto.Pushname - (*PastParticipants)(nil), // 132: proto.PastParticipants - (*PastParticipant)(nil), // 133: proto.PastParticipant - (*HistorySync)(nil), // 134: proto.HistorySync - (*HistorySyncMsg)(nil), // 135: proto.HistorySyncMsg - (*GroupParticipant)(nil), // 136: proto.GroupParticipant - (*GlobalSettings)(nil), // 137: proto.GlobalSettings - (*Conversation)(nil), // 138: proto.Conversation - (*AvatarUserSettings)(nil), // 139: proto.AvatarUserSettings - (*AutoDownloadSettings)(nil), // 140: proto.AutoDownloadSettings - (*MsgRowOpaqueData)(nil), // 141: proto.MsgRowOpaqueData - (*MsgOpaqueData)(nil), // 142: proto.MsgOpaqueData - (*ServerErrorReceipt)(nil), // 143: proto.ServerErrorReceipt - (*MediaRetryNotification)(nil), // 144: proto.MediaRetryNotification - (*MessageKey)(nil), // 145: proto.MessageKey - (*SyncdVersion)(nil), // 146: proto.SyncdVersion - (*SyncdValue)(nil), // 147: proto.SyncdValue - (*SyncdSnapshot)(nil), // 148: proto.SyncdSnapshot - (*SyncdRecord)(nil), // 149: proto.SyncdRecord - (*SyncdPatch)(nil), // 150: proto.SyncdPatch - (*SyncdMutations)(nil), // 151: proto.SyncdMutations - (*SyncdMutation)(nil), // 152: proto.SyncdMutation - (*SyncdIndex)(nil), // 153: proto.SyncdIndex - (*KeyId)(nil), // 154: proto.KeyId - (*ExternalBlobReference)(nil), // 155: proto.ExternalBlobReference - (*ExitCode)(nil), // 156: proto.ExitCode - (*SyncActionValue)(nil), // 157: proto.SyncActionValue - (*UserStatusMuteAction)(nil), // 158: proto.UserStatusMuteAction - (*UnarchiveChatsSetting)(nil), // 159: proto.UnarchiveChatsSetting - (*TimeFormatAction)(nil), // 160: proto.TimeFormatAction - (*SyncActionMessage)(nil), // 161: proto.SyncActionMessage - (*SyncActionMessageRange)(nil), // 162: proto.SyncActionMessageRange - (*SubscriptionAction)(nil), // 163: proto.SubscriptionAction - (*StickerAction)(nil), // 164: proto.StickerAction - (*StarAction)(nil), // 165: proto.StarAction - (*SecurityNotificationSetting)(nil), // 166: proto.SecurityNotificationSetting - (*RemoveRecentStickerAction)(nil), // 167: proto.RemoveRecentStickerAction - (*RecentEmojiWeightsAction)(nil), // 168: proto.RecentEmojiWeightsAction - (*QuickReplyAction)(nil), // 169: proto.QuickReplyAction - (*PushNameSetting)(nil), // 170: proto.PushNameSetting - (*PrimaryVersionAction)(nil), // 171: proto.PrimaryVersionAction - (*PrimaryFeature)(nil), // 172: proto.PrimaryFeature - (*PnForLidChatAction)(nil), // 173: proto.PnForLidChatAction - (*PinAction)(nil), // 174: proto.PinAction - (*NuxAction)(nil), // 175: proto.NuxAction - (*MuteAction)(nil), // 176: proto.MuteAction - (*MarkChatAsReadAction)(nil), // 177: proto.MarkChatAsReadAction - (*LocaleSetting)(nil), // 178: proto.LocaleSetting - (*LabelEditAction)(nil), // 179: proto.LabelEditAction - (*LabelAssociationAction)(nil), // 180: proto.LabelAssociationAction - (*KeyExpiration)(nil), // 181: proto.KeyExpiration - (*DeleteMessageForMeAction)(nil), // 182: proto.DeleteMessageForMeAction - (*DeleteChatAction)(nil), // 183: proto.DeleteChatAction - (*ContactAction)(nil), // 184: proto.ContactAction - (*ClearChatAction)(nil), // 185: proto.ClearChatAction - (*ChatAssignmentOpenedStatusAction)(nil), // 186: proto.ChatAssignmentOpenedStatusAction - (*ChatAssignmentAction)(nil), // 187: proto.ChatAssignmentAction - (*ArchiveChatAction)(nil), // 188: proto.ArchiveChatAction - (*AndroidUnsupportedActions)(nil), // 189: proto.AndroidUnsupportedActions - (*AgentAction)(nil), // 190: proto.AgentAction - (*SyncActionData)(nil), // 191: proto.SyncActionData - (*RecentEmojiWeight)(nil), // 192: proto.RecentEmojiWeight - (*VerifiedNameCertificate)(nil), // 193: proto.VerifiedNameCertificate - (*LocalizedName)(nil), // 194: proto.LocalizedName - (*BizIdentityInfo)(nil), // 195: proto.BizIdentityInfo - (*BizAccountPayload)(nil), // 196: proto.BizAccountPayload - (*BizAccountLinkInfo)(nil), // 197: proto.BizAccountLinkInfo - (*HandshakeMessage)(nil), // 198: proto.HandshakeMessage - (*HandshakeServerHello)(nil), // 199: proto.HandshakeServerHello - (*HandshakeClientHello)(nil), // 200: proto.HandshakeClientHello - (*HandshakeClientFinish)(nil), // 201: proto.HandshakeClientFinish - (*ClientPayload)(nil), // 202: proto.ClientPayload - (*WebNotificationsInfo)(nil), // 203: proto.WebNotificationsInfo - (*WebMessageInfo)(nil), // 204: proto.WebMessageInfo - (*WebFeatures)(nil), // 205: proto.WebFeatures - (*UserReceipt)(nil), // 206: proto.UserReceipt - (*StatusPSA)(nil), // 207: proto.StatusPSA - (*Reaction)(nil), // 208: proto.Reaction - (*PollUpdate)(nil), // 209: proto.PollUpdate - (*PollAdditionalMetadata)(nil), // 210: proto.PollAdditionalMetadata - (*PhotoChange)(nil), // 211: proto.PhotoChange - (*PaymentInfo)(nil), // 212: proto.PaymentInfo - (*NotificationMessageInfo)(nil), // 213: proto.NotificationMessageInfo - (*MediaData)(nil), // 214: proto.MediaData - (*KeepInChat)(nil), // 215: proto.KeepInChat - (*NoiseCertificate)(nil), // 216: proto.NoiseCertificate - (*CertChain)(nil), // 217: proto.CertChain - (*DeviceProps_HistorySyncConfig)(nil), // 218: proto.DeviceProps.HistorySyncConfig - (*DeviceProps_AppVersion)(nil), // 219: proto.DeviceProps.AppVersion - (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult)(nil), // 220: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult - (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse)(nil), // 221: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.LinkPreviewResponse - (*PeerDataOperationRequestMessage_RequestUrlPreview)(nil), // 222: proto.PeerDataOperationRequestMessage.RequestUrlPreview - (*PeerDataOperationRequestMessage_RequestStickerReupload)(nil), // 223: proto.PeerDataOperationRequestMessage.RequestStickerReupload - (*ListResponseMessage_SingleSelectReply)(nil), // 224: proto.ListResponseMessage.SingleSelectReply - (*ListMessage_Section)(nil), // 225: proto.ListMessage.Section - (*ListMessage_Row)(nil), // 226: proto.ListMessage.Row - (*ListMessage_Product)(nil), // 227: proto.ListMessage.Product - (*ListMessage_ProductSection)(nil), // 228: proto.ListMessage.ProductSection - (*ListMessage_ProductListInfo)(nil), // 229: proto.ListMessage.ProductListInfo - (*ListMessage_ProductListHeaderImage)(nil), // 230: proto.ListMessage.ProductListHeaderImage - (*InteractiveResponseMessage_NativeFlowResponseMessage)(nil), // 231: proto.InteractiveResponseMessage.NativeFlowResponseMessage - (*InteractiveResponseMessage_Body)(nil), // 232: proto.InteractiveResponseMessage.Body - (*InteractiveMessage_ShopMessage)(nil), // 233: proto.InteractiveMessage.ShopMessage - (*InteractiveMessage_NativeFlowMessage)(nil), // 234: proto.InteractiveMessage.NativeFlowMessage - (*InteractiveMessage_Header)(nil), // 235: proto.InteractiveMessage.Header - (*InteractiveMessage_Footer)(nil), // 236: proto.InteractiveMessage.Footer - (*InteractiveMessage_CollectionMessage)(nil), // 237: proto.InteractiveMessage.CollectionMessage - (*InteractiveMessage_Body)(nil), // 238: proto.InteractiveMessage.Body - (*InteractiveMessage_NativeFlowMessage_NativeFlowButton)(nil), // 239: proto.InteractiveMessage.NativeFlowMessage.NativeFlowButton - (*HighlyStructuredMessage_HSMLocalizableParameter)(nil), // 240: proto.HighlyStructuredMessage.HSMLocalizableParameter - (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime)(nil), // 241: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime - (*HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency)(nil), // 242: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMCurrency - (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch)(nil), // 243: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeUnixEpoch - (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent)(nil), // 244: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent - (*ButtonsMessage_Button)(nil), // 245: proto.ButtonsMessage.Button - (*ButtonsMessage_Button_NativeFlowInfo)(nil), // 246: proto.ButtonsMessage.Button.NativeFlowInfo - (*ButtonsMessage_Button_ButtonText)(nil), // 247: proto.ButtonsMessage.Button.ButtonText - (*HydratedTemplateButton_HydratedURLButton)(nil), // 248: proto.HydratedTemplateButton.HydratedURLButton - (*HydratedTemplateButton_HydratedQuickReplyButton)(nil), // 249: proto.HydratedTemplateButton.HydratedQuickReplyButton - (*HydratedTemplateButton_HydratedCallButton)(nil), // 250: proto.HydratedTemplateButton.HydratedCallButton - (*ContextInfo_ExternalAdReplyInfo)(nil), // 251: proto.ContextInfo.ExternalAdReplyInfo - (*ContextInfo_AdReplyInfo)(nil), // 252: proto.ContextInfo.AdReplyInfo - (*TemplateButton_URLButton)(nil), // 253: proto.TemplateButton.URLButton - (*TemplateButton_QuickReplyButton)(nil), // 254: proto.TemplateButton.QuickReplyButton - (*TemplateButton_CallButton)(nil), // 255: proto.TemplateButton.CallButton - (*PaymentBackground_MediaData)(nil), // 256: proto.PaymentBackground.MediaData - (*TemplateMessage_HydratedFourRowTemplate)(nil), // 257: proto.TemplateMessage.HydratedFourRowTemplate - (*TemplateMessage_FourRowTemplate)(nil), // 258: proto.TemplateMessage.FourRowTemplate - (*ProductMessage_ProductSnapshot)(nil), // 259: proto.ProductMessage.ProductSnapshot - (*ProductMessage_CatalogSnapshot)(nil), // 260: proto.ProductMessage.CatalogSnapshot - (*PollCreationMessage_Option)(nil), // 261: proto.PollCreationMessage.Option - (*MsgOpaqueData_PollOption)(nil), // 262: proto.MsgOpaqueData.PollOption - (*VerifiedNameCertificate_Details)(nil), // 263: proto.VerifiedNameCertificate.Details - (*ClientPayload_WebInfo)(nil), // 264: proto.ClientPayload.WebInfo - (*ClientPayload_UserAgent)(nil), // 265: proto.ClientPayload.UserAgent - (*ClientPayload_DevicePairingRegistrationData)(nil), // 266: proto.ClientPayload.DevicePairingRegistrationData - (*ClientPayload_DNSSource)(nil), // 267: proto.ClientPayload.DNSSource - (*ClientPayload_WebInfo_WebdPayload)(nil), // 268: proto.ClientPayload.WebInfo.WebdPayload - (*ClientPayload_UserAgent_AppVersion)(nil), // 269: proto.ClientPayload.UserAgent.AppVersion - (*NoiseCertificate_Details)(nil), // 270: proto.NoiseCertificate.Details - (*CertChain_NoiseCertificate)(nil), // 271: proto.CertChain.NoiseCertificate - (*CertChain_NoiseCertificate_Details)(nil), // 272: proto.CertChain.NoiseCertificate.Details + (GroupInviteMessage_GroupType)(0), // 14: proto.GroupInviteMessage.GroupType + (ExtendedTextMessage_PreviewType)(0), // 15: proto.ExtendedTextMessage.PreviewType + (ExtendedTextMessage_InviteLinkGroupType)(0), // 16: proto.ExtendedTextMessage.InviteLinkGroupType + (ExtendedTextMessage_FontType)(0), // 17: proto.ExtendedTextMessage.FontType + (ButtonsResponseMessage_Type)(0), // 18: proto.ButtonsResponseMessage.Type + (ButtonsMessage_HeaderType)(0), // 19: proto.ButtonsMessage.HeaderType + (ButtonsMessage_Button_Type)(0), // 20: proto.ButtonsMessage.Button.Type + (DisappearingMode_Initiator)(0), // 21: proto.DisappearingMode.Initiator + (ContextInfo_ExternalAdReplyInfo_MediaType)(0), // 22: proto.ContextInfo.ExternalAdReplyInfo.MediaType + (ContextInfo_AdReplyInfo_MediaType)(0), // 23: proto.ContextInfo.AdReplyInfo.MediaType + (PaymentBackground_Type)(0), // 24: proto.PaymentBackground.Type + (VideoMessage_Attribution)(0), // 25: proto.VideoMessage.Attribution + (ScheduledCallEditMessage_EditType)(0), // 26: proto.ScheduledCallEditMessage.EditType + (ScheduledCallCreationMessage_CallType)(0), // 27: proto.ScheduledCallCreationMessage.CallType + (ProtocolMessage_Type)(0), // 28: proto.ProtocolMessage.Type + (PinMessage_PinMessageType)(0), // 29: proto.PinMessage.PinMessageType + (PastParticipant_LeaveReason)(0), // 30: proto.PastParticipant.LeaveReason + (HistorySync_HistorySyncType)(0), // 31: proto.HistorySync.HistorySyncType + (GroupParticipant_Rank)(0), // 32: proto.GroupParticipant.Rank + (Conversation_EndOfHistoryTransferType)(0), // 33: proto.Conversation.EndOfHistoryTransferType + (MediaRetryNotification_ResultType)(0), // 34: proto.MediaRetryNotification.ResultType + (SyncdMutation_SyncdOperation)(0), // 35: proto.SyncdMutation.SyncdOperation + (BizIdentityInfo_VerifiedLevelValue)(0), // 36: proto.BizIdentityInfo.VerifiedLevelValue + (BizIdentityInfo_HostStorageType)(0), // 37: proto.BizIdentityInfo.HostStorageType + (BizIdentityInfo_ActualActorsType)(0), // 38: proto.BizIdentityInfo.ActualActorsType + (BizAccountLinkInfo_HostStorageType)(0), // 39: proto.BizAccountLinkInfo.HostStorageType + (BizAccountLinkInfo_AccountType)(0), // 40: proto.BizAccountLinkInfo.AccountType + (ClientPayload_Product)(0), // 41: proto.ClientPayload.Product + (ClientPayload_IOSAppExtension)(0), // 42: proto.ClientPayload.IOSAppExtension + (ClientPayload_ConnectType)(0), // 43: proto.ClientPayload.ConnectType + (ClientPayload_ConnectReason)(0), // 44: proto.ClientPayload.ConnectReason + (ClientPayload_WebInfo_WebSubPlatform)(0), // 45: proto.ClientPayload.WebInfo.WebSubPlatform + (ClientPayload_UserAgent_ReleaseChannel)(0), // 46: proto.ClientPayload.UserAgent.ReleaseChannel + (ClientPayload_UserAgent_Platform)(0), // 47: proto.ClientPayload.UserAgent.Platform + (ClientPayload_DNSSource_DNSResolutionMethod)(0), // 48: proto.ClientPayload.DNSSource.DNSResolutionMethod + (WebMessageInfo_StubType)(0), // 49: proto.WebMessageInfo.StubType + (WebMessageInfo_Status)(0), // 50: proto.WebMessageInfo.Status + (WebMessageInfo_BizPrivacyStatus)(0), // 51: proto.WebMessageInfo.BizPrivacyStatus + (WebFeatures_Flag)(0), // 52: proto.WebFeatures.Flag + (PaymentInfo_TxnStatus)(0), // 53: proto.PaymentInfo.TxnStatus + (PaymentInfo_Status)(0), // 54: proto.PaymentInfo.Status + (PaymentInfo_Currency)(0), // 55: proto.PaymentInfo.Currency + (*ADVSignedKeyIndexList)(nil), // 56: proto.ADVSignedKeyIndexList + (*ADVSignedDeviceIdentity)(nil), // 57: proto.ADVSignedDeviceIdentity + (*ADVSignedDeviceIdentityHMAC)(nil), // 58: proto.ADVSignedDeviceIdentityHMAC + (*ADVKeyIndexList)(nil), // 59: proto.ADVKeyIndexList + (*ADVDeviceIdentity)(nil), // 60: proto.ADVDeviceIdentity + (*DeviceProps)(nil), // 61: proto.DeviceProps + (*PeerDataOperationRequestMessage)(nil), // 62: proto.PeerDataOperationRequestMessage + (*PaymentInviteMessage)(nil), // 63: proto.PaymentInviteMessage + (*OrderMessage)(nil), // 64: proto.OrderMessage + (*LocationMessage)(nil), // 65: proto.LocationMessage + (*LiveLocationMessage)(nil), // 66: proto.LiveLocationMessage + (*ListResponseMessage)(nil), // 67: proto.ListResponseMessage + (*ListMessage)(nil), // 68: proto.ListMessage + (*KeepInChatMessage)(nil), // 69: proto.KeepInChatMessage + (*InvoiceMessage)(nil), // 70: proto.InvoiceMessage + (*InteractiveResponseMessage)(nil), // 71: proto.InteractiveResponseMessage + (*InteractiveMessage)(nil), // 72: proto.InteractiveMessage + (*InitialSecurityNotificationSettingSync)(nil), // 73: proto.InitialSecurityNotificationSettingSync + (*ImageMessage)(nil), // 74: proto.ImageMessage + (*HistorySyncNotification)(nil), // 75: proto.HistorySyncNotification + (*HighlyStructuredMessage)(nil), // 76: proto.HighlyStructuredMessage + (*GroupInviteMessage)(nil), // 77: proto.GroupInviteMessage + (*FutureProofMessage)(nil), // 78: proto.FutureProofMessage + (*ExtendedTextMessage)(nil), // 79: proto.ExtendedTextMessage + (*EncReactionMessage)(nil), // 80: proto.EncReactionMessage + (*DocumentMessage)(nil), // 81: proto.DocumentMessage + (*DeviceSentMessage)(nil), // 82: proto.DeviceSentMessage + (*DeclinePaymentRequestMessage)(nil), // 83: proto.DeclinePaymentRequestMessage + (*ContactsArrayMessage)(nil), // 84: proto.ContactsArrayMessage + (*ContactMessage)(nil), // 85: proto.ContactMessage + (*Chat)(nil), // 86: proto.Chat + (*CancelPaymentRequestMessage)(nil), // 87: proto.CancelPaymentRequestMessage + (*Call)(nil), // 88: proto.Call + (*ButtonsResponseMessage)(nil), // 89: proto.ButtonsResponseMessage + (*ButtonsMessage)(nil), // 90: proto.ButtonsMessage + (*AudioMessage)(nil), // 91: proto.AudioMessage + (*AppStateSyncKey)(nil), // 92: proto.AppStateSyncKey + (*AppStateSyncKeyShare)(nil), // 93: proto.AppStateSyncKeyShare + (*AppStateSyncKeyRequest)(nil), // 94: proto.AppStateSyncKeyRequest + (*AppStateSyncKeyId)(nil), // 95: proto.AppStateSyncKeyId + (*AppStateSyncKeyFingerprint)(nil), // 96: proto.AppStateSyncKeyFingerprint + (*AppStateSyncKeyData)(nil), // 97: proto.AppStateSyncKeyData + (*AppStateFatalExceptionNotification)(nil), // 98: proto.AppStateFatalExceptionNotification + (*Location)(nil), // 99: proto.Location + (*InteractiveAnnotation)(nil), // 100: proto.InteractiveAnnotation + (*HydratedTemplateButton)(nil), // 101: proto.HydratedTemplateButton + (*GroupMention)(nil), // 102: proto.GroupMention + (*DisappearingMode)(nil), // 103: proto.DisappearingMode + (*DeviceListMetadata)(nil), // 104: proto.DeviceListMetadata + (*ContextInfo)(nil), // 105: proto.ContextInfo + (*ActionLink)(nil), // 106: proto.ActionLink + (*TemplateButton)(nil), // 107: proto.TemplateButton + (*Point)(nil), // 108: proto.Point + (*PaymentBackground)(nil), // 109: proto.PaymentBackground + (*Money)(nil), // 110: proto.Money + (*Message)(nil), // 111: proto.Message + (*MessageContextInfo)(nil), // 112: proto.MessageContextInfo + (*VideoMessage)(nil), // 113: proto.VideoMessage + (*TemplateMessage)(nil), // 114: proto.TemplateMessage + (*TemplateButtonReplyMessage)(nil), // 115: proto.TemplateButtonReplyMessage + (*StickerSyncRMRMessage)(nil), // 116: proto.StickerSyncRMRMessage + (*StickerMessage)(nil), // 117: proto.StickerMessage + (*SenderKeyDistributionMessage)(nil), // 118: proto.SenderKeyDistributionMessage + (*SendPaymentMessage)(nil), // 119: proto.SendPaymentMessage + (*ScheduledCallEditMessage)(nil), // 120: proto.ScheduledCallEditMessage + (*ScheduledCallCreationMessage)(nil), // 121: proto.ScheduledCallCreationMessage + (*RequestPhoneNumberMessage)(nil), // 122: proto.RequestPhoneNumberMessage + (*RequestPaymentMessage)(nil), // 123: proto.RequestPaymentMessage + (*ReactionMessage)(nil), // 124: proto.ReactionMessage + (*ProtocolMessage)(nil), // 125: proto.ProtocolMessage + (*ProductMessage)(nil), // 126: proto.ProductMessage + (*PollVoteMessage)(nil), // 127: proto.PollVoteMessage + (*PollUpdateMessage)(nil), // 128: proto.PollUpdateMessage + (*PollUpdateMessageMetadata)(nil), // 129: proto.PollUpdateMessageMetadata + (*PollEncValue)(nil), // 130: proto.PollEncValue + (*PollCreationMessage)(nil), // 131: proto.PollCreationMessage + (*PinMessage)(nil), // 132: proto.PinMessage + (*PeerDataOperationRequestResponseMessage)(nil), // 133: proto.PeerDataOperationRequestResponseMessage + (*EphemeralSetting)(nil), // 134: proto.EphemeralSetting + (*WallpaperSettings)(nil), // 135: proto.WallpaperSettings + (*StickerMetadata)(nil), // 136: proto.StickerMetadata + (*Pushname)(nil), // 137: proto.Pushname + (*PastParticipants)(nil), // 138: proto.PastParticipants + (*PastParticipant)(nil), // 139: proto.PastParticipant + (*HistorySync)(nil), // 140: proto.HistorySync + (*HistorySyncMsg)(nil), // 141: proto.HistorySyncMsg + (*GroupParticipant)(nil), // 142: proto.GroupParticipant + (*GlobalSettings)(nil), // 143: proto.GlobalSettings + (*Conversation)(nil), // 144: proto.Conversation + (*AvatarUserSettings)(nil), // 145: proto.AvatarUserSettings + (*AutoDownloadSettings)(nil), // 146: proto.AutoDownloadSettings + (*MsgRowOpaqueData)(nil), // 147: proto.MsgRowOpaqueData + (*MsgOpaqueData)(nil), // 148: proto.MsgOpaqueData + (*ServerErrorReceipt)(nil), // 149: proto.ServerErrorReceipt + (*MediaRetryNotification)(nil), // 150: proto.MediaRetryNotification + (*MessageKey)(nil), // 151: proto.MessageKey + (*SyncdVersion)(nil), // 152: proto.SyncdVersion + (*SyncdValue)(nil), // 153: proto.SyncdValue + (*SyncdSnapshot)(nil), // 154: proto.SyncdSnapshot + (*SyncdRecord)(nil), // 155: proto.SyncdRecord + (*SyncdPatch)(nil), // 156: proto.SyncdPatch + (*SyncdMutations)(nil), // 157: proto.SyncdMutations + (*SyncdMutation)(nil), // 158: proto.SyncdMutation + (*SyncdIndex)(nil), // 159: proto.SyncdIndex + (*KeyId)(nil), // 160: proto.KeyId + (*ExternalBlobReference)(nil), // 161: proto.ExternalBlobReference + (*ExitCode)(nil), // 162: proto.ExitCode + (*SyncActionValue)(nil), // 163: proto.SyncActionValue + (*UserStatusMuteAction)(nil), // 164: proto.UserStatusMuteAction + (*UnarchiveChatsSetting)(nil), // 165: proto.UnarchiveChatsSetting + (*TimeFormatAction)(nil), // 166: proto.TimeFormatAction + (*SyncActionMessage)(nil), // 167: proto.SyncActionMessage + (*SyncActionMessageRange)(nil), // 168: proto.SyncActionMessageRange + (*SubscriptionAction)(nil), // 169: proto.SubscriptionAction + (*StickerAction)(nil), // 170: proto.StickerAction + (*StarAction)(nil), // 171: proto.StarAction + (*SecurityNotificationSetting)(nil), // 172: proto.SecurityNotificationSetting + (*RemoveRecentStickerAction)(nil), // 173: proto.RemoveRecentStickerAction + (*RecentEmojiWeightsAction)(nil), // 174: proto.RecentEmojiWeightsAction + (*QuickReplyAction)(nil), // 175: proto.QuickReplyAction + (*PushNameSetting)(nil), // 176: proto.PushNameSetting + (*PrimaryVersionAction)(nil), // 177: proto.PrimaryVersionAction + (*PrimaryFeature)(nil), // 178: proto.PrimaryFeature + (*PnForLidChatAction)(nil), // 179: proto.PnForLidChatAction + (*PinAction)(nil), // 180: proto.PinAction + (*NuxAction)(nil), // 181: proto.NuxAction + (*MuteAction)(nil), // 182: proto.MuteAction + (*MarkChatAsReadAction)(nil), // 183: proto.MarkChatAsReadAction + (*LocaleSetting)(nil), // 184: proto.LocaleSetting + (*LabelEditAction)(nil), // 185: proto.LabelEditAction + (*LabelAssociationAction)(nil), // 186: proto.LabelAssociationAction + (*KeyExpiration)(nil), // 187: proto.KeyExpiration + (*DeleteMessageForMeAction)(nil), // 188: proto.DeleteMessageForMeAction + (*DeleteChatAction)(nil), // 189: proto.DeleteChatAction + (*ContactAction)(nil), // 190: proto.ContactAction + (*ClearChatAction)(nil), // 191: proto.ClearChatAction + (*ChatAssignmentOpenedStatusAction)(nil), // 192: proto.ChatAssignmentOpenedStatusAction + (*ChatAssignmentAction)(nil), // 193: proto.ChatAssignmentAction + (*ArchiveChatAction)(nil), // 194: proto.ArchiveChatAction + (*AndroidUnsupportedActions)(nil), // 195: proto.AndroidUnsupportedActions + (*AgentAction)(nil), // 196: proto.AgentAction + (*SyncActionData)(nil), // 197: proto.SyncActionData + (*RecentEmojiWeight)(nil), // 198: proto.RecentEmojiWeight + (*VerifiedNameCertificate)(nil), // 199: proto.VerifiedNameCertificate + (*LocalizedName)(nil), // 200: proto.LocalizedName + (*BizIdentityInfo)(nil), // 201: proto.BizIdentityInfo + (*BizAccountPayload)(nil), // 202: proto.BizAccountPayload + (*BizAccountLinkInfo)(nil), // 203: proto.BizAccountLinkInfo + (*HandshakeMessage)(nil), // 204: proto.HandshakeMessage + (*HandshakeServerHello)(nil), // 205: proto.HandshakeServerHello + (*HandshakeClientHello)(nil), // 206: proto.HandshakeClientHello + (*HandshakeClientFinish)(nil), // 207: proto.HandshakeClientFinish + (*ClientPayload)(nil), // 208: proto.ClientPayload + (*WebNotificationsInfo)(nil), // 209: proto.WebNotificationsInfo + (*WebMessageInfo)(nil), // 210: proto.WebMessageInfo + (*WebFeatures)(nil), // 211: proto.WebFeatures + (*UserReceipt)(nil), // 212: proto.UserReceipt + (*StatusPSA)(nil), // 213: proto.StatusPSA + (*Reaction)(nil), // 214: proto.Reaction + (*PollUpdate)(nil), // 215: proto.PollUpdate + (*PollAdditionalMetadata)(nil), // 216: proto.PollAdditionalMetadata + (*PhotoChange)(nil), // 217: proto.PhotoChange + (*PaymentInfo)(nil), // 218: proto.PaymentInfo + (*NotificationMessageInfo)(nil), // 219: proto.NotificationMessageInfo + (*MediaData)(nil), // 220: proto.MediaData + (*KeepInChat)(nil), // 221: proto.KeepInChat + (*NoiseCertificate)(nil), // 222: proto.NoiseCertificate + (*CertChain)(nil), // 223: proto.CertChain + (*DeviceProps_HistorySyncConfig)(nil), // 224: proto.DeviceProps.HistorySyncConfig + (*DeviceProps_AppVersion)(nil), // 225: proto.DeviceProps.AppVersion + (*PeerDataOperationRequestMessage_RequestUrlPreview)(nil), // 226: proto.PeerDataOperationRequestMessage.RequestUrlPreview + (*PeerDataOperationRequestMessage_RequestStickerReupload)(nil), // 227: proto.PeerDataOperationRequestMessage.RequestStickerReupload + (*PeerDataOperationRequestMessage_HistorySyncOnDemandRequest)(nil), // 228: proto.PeerDataOperationRequestMessage.HistorySyncOnDemandRequest + (*ListResponseMessage_SingleSelectReply)(nil), // 229: proto.ListResponseMessage.SingleSelectReply + (*ListMessage_Section)(nil), // 230: proto.ListMessage.Section + (*ListMessage_Row)(nil), // 231: proto.ListMessage.Row + (*ListMessage_Product)(nil), // 232: proto.ListMessage.Product + (*ListMessage_ProductSection)(nil), // 233: proto.ListMessage.ProductSection + (*ListMessage_ProductListInfo)(nil), // 234: proto.ListMessage.ProductListInfo + (*ListMessage_ProductListHeaderImage)(nil), // 235: proto.ListMessage.ProductListHeaderImage + (*InteractiveResponseMessage_NativeFlowResponseMessage)(nil), // 236: proto.InteractiveResponseMessage.NativeFlowResponseMessage + (*InteractiveResponseMessage_Body)(nil), // 237: proto.InteractiveResponseMessage.Body + (*InteractiveMessage_ShopMessage)(nil), // 238: proto.InteractiveMessage.ShopMessage + (*InteractiveMessage_NativeFlowMessage)(nil), // 239: proto.InteractiveMessage.NativeFlowMessage + (*InteractiveMessage_Header)(nil), // 240: proto.InteractiveMessage.Header + (*InteractiveMessage_Footer)(nil), // 241: proto.InteractiveMessage.Footer + (*InteractiveMessage_CollectionMessage)(nil), // 242: proto.InteractiveMessage.CollectionMessage + (*InteractiveMessage_Body)(nil), // 243: proto.InteractiveMessage.Body + (*InteractiveMessage_NativeFlowMessage_NativeFlowButton)(nil), // 244: proto.InteractiveMessage.NativeFlowMessage.NativeFlowButton + (*HighlyStructuredMessage_HSMLocalizableParameter)(nil), // 245: proto.HighlyStructuredMessage.HSMLocalizableParameter + (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime)(nil), // 246: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime + (*HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency)(nil), // 247: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMCurrency + (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch)(nil), // 248: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeUnixEpoch + (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent)(nil), // 249: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent + (*ButtonsMessage_Button)(nil), // 250: proto.ButtonsMessage.Button + (*ButtonsMessage_Button_NativeFlowInfo)(nil), // 251: proto.ButtonsMessage.Button.NativeFlowInfo + (*ButtonsMessage_Button_ButtonText)(nil), // 252: proto.ButtonsMessage.Button.ButtonText + (*HydratedTemplateButton_HydratedURLButton)(nil), // 253: proto.HydratedTemplateButton.HydratedURLButton + (*HydratedTemplateButton_HydratedQuickReplyButton)(nil), // 254: proto.HydratedTemplateButton.HydratedQuickReplyButton + (*HydratedTemplateButton_HydratedCallButton)(nil), // 255: proto.HydratedTemplateButton.HydratedCallButton + (*ContextInfo_UTMInfo)(nil), // 256: proto.ContextInfo.UTMInfo + (*ContextInfo_ExternalAdReplyInfo)(nil), // 257: proto.ContextInfo.ExternalAdReplyInfo + (*ContextInfo_AdReplyInfo)(nil), // 258: proto.ContextInfo.AdReplyInfo + (*TemplateButton_URLButton)(nil), // 259: proto.TemplateButton.URLButton + (*TemplateButton_QuickReplyButton)(nil), // 260: proto.TemplateButton.QuickReplyButton + (*TemplateButton_CallButton)(nil), // 261: proto.TemplateButton.CallButton + (*PaymentBackground_MediaData)(nil), // 262: proto.PaymentBackground.MediaData + (*TemplateMessage_HydratedFourRowTemplate)(nil), // 263: proto.TemplateMessage.HydratedFourRowTemplate + (*TemplateMessage_FourRowTemplate)(nil), // 264: proto.TemplateMessage.FourRowTemplate + (*ProductMessage_ProductSnapshot)(nil), // 265: proto.ProductMessage.ProductSnapshot + (*ProductMessage_CatalogSnapshot)(nil), // 266: proto.ProductMessage.CatalogSnapshot + (*PollCreationMessage_Option)(nil), // 267: proto.PollCreationMessage.Option + (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult)(nil), // 268: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult + (*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse)(nil), // 269: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.LinkPreviewResponse + (*MsgOpaqueData_PollOption)(nil), // 270: proto.MsgOpaqueData.PollOption + (*VerifiedNameCertificate_Details)(nil), // 271: proto.VerifiedNameCertificate.Details + (*ClientPayload_WebInfo)(nil), // 272: proto.ClientPayload.WebInfo + (*ClientPayload_UserAgent)(nil), // 273: proto.ClientPayload.UserAgent + (*ClientPayload_DevicePairingRegistrationData)(nil), // 274: proto.ClientPayload.DevicePairingRegistrationData + (*ClientPayload_DNSSource)(nil), // 275: proto.ClientPayload.DNSSource + (*ClientPayload_WebInfo_WebdPayload)(nil), // 276: proto.ClientPayload.WebInfo.WebdPayload + (*ClientPayload_UserAgent_AppVersion)(nil), // 277: proto.ClientPayload.UserAgent.AppVersion + (*NoiseCertificate_Details)(nil), // 278: proto.NoiseCertificate.Details + (*CertChain_NoiseCertificate)(nil), // 279: proto.CertChain.NoiseCertificate + (*CertChain_NoiseCertificate_Details)(nil), // 280: proto.CertChain.NoiseCertificate.Details } var file_binary_proto_def_proto_depIdxs = []int32{ - 219, // 0: proto.DeviceProps.version:type_name -> proto.DeviceProps.AppVersion + 225, // 0: proto.DeviceProps.version:type_name -> proto.DeviceProps.AppVersion 3, // 1: proto.DeviceProps.platformType:type_name -> proto.DeviceProps.PlatformType - 218, // 2: proto.DeviceProps.historySyncConfig:type_name -> proto.DeviceProps.HistorySyncConfig - 0, // 3: proto.PeerDataOperationRequestResponseMessage.peerDataOperationRequestType:type_name -> proto.PeerDataOperationRequestType - 220, // 4: proto.PeerDataOperationRequestResponseMessage.peerDataOperationResult:type_name -> proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult - 0, // 5: proto.PeerDataOperationRequestMessage.peerDataOperationRequestType:type_name -> proto.PeerDataOperationRequestType - 223, // 6: proto.PeerDataOperationRequestMessage.requestStickerReupload:type_name -> proto.PeerDataOperationRequestMessage.RequestStickerReupload - 222, // 7: proto.PeerDataOperationRequestMessage.requestUrlPreview:type_name -> proto.PeerDataOperationRequestMessage.RequestUrlPreview - 4, // 8: proto.PaymentInviteMessage.serviceType:type_name -> proto.PaymentInviteMessage.ServiceType - 6, // 9: proto.OrderMessage.status:type_name -> proto.OrderMessage.OrderStatus - 5, // 10: proto.OrderMessage.surface:type_name -> proto.OrderMessage.OrderSurface - 103, // 11: proto.OrderMessage.contextInfo:type_name -> proto.ContextInfo - 103, // 12: proto.LocationMessage.contextInfo:type_name -> proto.ContextInfo - 103, // 13: proto.LiveLocationMessage.contextInfo:type_name -> proto.ContextInfo - 7, // 14: proto.ListResponseMessage.listType:type_name -> proto.ListResponseMessage.ListType - 224, // 15: proto.ListResponseMessage.singleSelectReply:type_name -> proto.ListResponseMessage.SingleSelectReply - 103, // 16: proto.ListResponseMessage.contextInfo:type_name -> proto.ContextInfo - 8, // 17: proto.ListMessage.listType:type_name -> proto.ListMessage.ListType - 225, // 18: proto.ListMessage.sections:type_name -> proto.ListMessage.Section - 229, // 19: proto.ListMessage.productListInfo:type_name -> proto.ListMessage.ProductListInfo - 103, // 20: proto.ListMessage.contextInfo:type_name -> proto.ContextInfo - 145, // 21: proto.KeepInChatMessage.key:type_name -> proto.MessageKey - 1, // 22: proto.KeepInChatMessage.keepType:type_name -> proto.KeepType - 9, // 23: proto.InvoiceMessage.attachmentType:type_name -> proto.InvoiceMessage.AttachmentType - 232, // 24: proto.InteractiveResponseMessage.body:type_name -> proto.InteractiveResponseMessage.Body - 103, // 25: proto.InteractiveResponseMessage.contextInfo:type_name -> proto.ContextInfo - 231, // 26: proto.InteractiveResponseMessage.nativeFlowResponseMessage:type_name -> proto.InteractiveResponseMessage.NativeFlowResponseMessage - 235, // 27: proto.InteractiveMessage.header:type_name -> proto.InteractiveMessage.Header - 238, // 28: proto.InteractiveMessage.body:type_name -> proto.InteractiveMessage.Body - 236, // 29: proto.InteractiveMessage.footer:type_name -> proto.InteractiveMessage.Footer - 103, // 30: proto.InteractiveMessage.contextInfo:type_name -> proto.ContextInfo - 233, // 31: proto.InteractiveMessage.shopStorefrontMessage:type_name -> proto.InteractiveMessage.ShopMessage - 237, // 32: proto.InteractiveMessage.collectionMessage:type_name -> proto.InteractiveMessage.CollectionMessage - 234, // 33: proto.InteractiveMessage.nativeFlowMessage:type_name -> proto.InteractiveMessage.NativeFlowMessage - 99, // 34: proto.ImageMessage.interactiveAnnotations:type_name -> proto.InteractiveAnnotation - 103, // 35: proto.ImageMessage.contextInfo:type_name -> proto.ContextInfo - 11, // 36: proto.HistorySyncNotification.syncType:type_name -> proto.HistorySyncNotification.HistorySyncType - 240, // 37: proto.HighlyStructuredMessage.localizableParams:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter - 112, // 38: proto.HighlyStructuredMessage.hydratedHsm:type_name -> proto.TemplateMessage - 103, // 39: proto.GroupInviteMessage.contextInfo:type_name -> proto.ContextInfo - 14, // 40: proto.GroupInviteMessage.groupType:type_name -> proto.GroupInviteMessage.GroupType - 109, // 41: proto.FutureProofMessage.message:type_name -> proto.Message - 17, // 42: proto.ExtendedTextMessage.font:type_name -> proto.ExtendedTextMessage.FontType - 15, // 43: proto.ExtendedTextMessage.previewType:type_name -> proto.ExtendedTextMessage.PreviewType - 103, // 44: proto.ExtendedTextMessage.contextInfo:type_name -> proto.ContextInfo - 16, // 45: proto.ExtendedTextMessage.inviteLinkGroupType:type_name -> proto.ExtendedTextMessage.InviteLinkGroupType - 16, // 46: proto.ExtendedTextMessage.inviteLinkGroupTypeV2:type_name -> proto.ExtendedTextMessage.InviteLinkGroupType - 145, // 47: proto.EncReactionMessage.targetMessageKey:type_name -> proto.MessageKey - 103, // 48: proto.DocumentMessage.contextInfo:type_name -> proto.ContextInfo - 109, // 49: proto.DeviceSentMessage.message:type_name -> proto.Message - 145, // 50: proto.DeclinePaymentRequestMessage.key:type_name -> proto.MessageKey - 84, // 51: proto.ContactsArrayMessage.contacts:type_name -> proto.ContactMessage - 103, // 52: proto.ContactsArrayMessage.contextInfo:type_name -> proto.ContextInfo - 103, // 53: proto.ContactMessage.contextInfo:type_name -> proto.ContextInfo - 145, // 54: proto.CancelPaymentRequestMessage.key:type_name -> proto.MessageKey - 103, // 55: proto.ButtonsResponseMessage.contextInfo:type_name -> proto.ContextInfo - 18, // 56: proto.ButtonsResponseMessage.type:type_name -> proto.ButtonsResponseMessage.Type - 103, // 57: proto.ButtonsMessage.contextInfo:type_name -> proto.ContextInfo - 245, // 58: proto.ButtonsMessage.buttons:type_name -> proto.ButtonsMessage.Button - 19, // 59: proto.ButtonsMessage.headerType:type_name -> proto.ButtonsMessage.HeaderType - 80, // 60: proto.ButtonsMessage.documentMessage:type_name -> proto.DocumentMessage - 73, // 61: proto.ButtonsMessage.imageMessage:type_name -> proto.ImageMessage - 111, // 62: proto.ButtonsMessage.videoMessage:type_name -> proto.VideoMessage - 64, // 63: proto.ButtonsMessage.locationMessage:type_name -> proto.LocationMessage - 103, // 64: proto.AudioMessage.contextInfo:type_name -> proto.ContextInfo - 94, // 65: proto.AppStateSyncKey.keyId:type_name -> proto.AppStateSyncKeyId - 96, // 66: proto.AppStateSyncKey.keyData:type_name -> proto.AppStateSyncKeyData - 91, // 67: proto.AppStateSyncKeyShare.keys:type_name -> proto.AppStateSyncKey - 94, // 68: proto.AppStateSyncKeyRequest.keyIds:type_name -> proto.AppStateSyncKeyId - 95, // 69: proto.AppStateSyncKeyData.fingerprint:type_name -> proto.AppStateSyncKeyFingerprint - 106, // 70: proto.InteractiveAnnotation.polygonVertices:type_name -> proto.Point - 98, // 71: proto.InteractiveAnnotation.location:type_name -> proto.Location - 249, // 72: proto.HydratedTemplateButton.quickReplyButton:type_name -> proto.HydratedTemplateButton.HydratedQuickReplyButton - 248, // 73: proto.HydratedTemplateButton.urlButton:type_name -> proto.HydratedTemplateButton.HydratedURLButton - 250, // 74: proto.HydratedTemplateButton.callButton:type_name -> proto.HydratedTemplateButton.HydratedCallButton - 21, // 75: proto.DisappearingMode.initiator:type_name -> proto.DisappearingMode.Initiator - 109, // 76: proto.ContextInfo.quotedMessage:type_name -> proto.Message - 252, // 77: proto.ContextInfo.quotedAd:type_name -> proto.ContextInfo.AdReplyInfo - 145, // 78: proto.ContextInfo.placeholderKey:type_name -> proto.MessageKey - 251, // 79: proto.ContextInfo.externalAdReply:type_name -> proto.ContextInfo.ExternalAdReplyInfo - 101, // 80: proto.ContextInfo.disappearingMode:type_name -> proto.DisappearingMode - 104, // 81: proto.ContextInfo.actionLink:type_name -> proto.ActionLink - 254, // 82: proto.TemplateButton.quickReplyButton:type_name -> proto.TemplateButton.QuickReplyButton - 253, // 83: proto.TemplateButton.urlButton:type_name -> proto.TemplateButton.URLButton - 255, // 84: proto.TemplateButton.callButton:type_name -> proto.TemplateButton.CallButton - 256, // 85: proto.PaymentBackground.mediaData:type_name -> proto.PaymentBackground.MediaData - 24, // 86: proto.PaymentBackground.type:type_name -> proto.PaymentBackground.Type - 116, // 87: proto.Message.senderKeyDistributionMessage:type_name -> proto.SenderKeyDistributionMessage - 73, // 88: proto.Message.imageMessage:type_name -> proto.ImageMessage - 84, // 89: proto.Message.contactMessage:type_name -> proto.ContactMessage - 64, // 90: proto.Message.locationMessage:type_name -> proto.LocationMessage - 78, // 91: proto.Message.extendedTextMessage:type_name -> proto.ExtendedTextMessage - 80, // 92: proto.Message.documentMessage:type_name -> proto.DocumentMessage - 90, // 93: proto.Message.audioMessage:type_name -> proto.AudioMessage - 111, // 94: proto.Message.videoMessage:type_name -> proto.VideoMessage - 87, // 95: proto.Message.call:type_name -> proto.Call - 85, // 96: proto.Message.chat:type_name -> proto.Chat - 121, // 97: proto.Message.protocolMessage:type_name -> proto.ProtocolMessage - 83, // 98: proto.Message.contactsArrayMessage:type_name -> proto.ContactsArrayMessage - 75, // 99: proto.Message.highlyStructuredMessage:type_name -> proto.HighlyStructuredMessage - 116, // 100: proto.Message.fastRatchetKeySenderKeyDistributionMessage:type_name -> proto.SenderKeyDistributionMessage - 117, // 101: proto.Message.sendPaymentMessage:type_name -> proto.SendPaymentMessage - 65, // 102: proto.Message.liveLocationMessage:type_name -> proto.LiveLocationMessage - 119, // 103: proto.Message.requestPaymentMessage:type_name -> proto.RequestPaymentMessage - 82, // 104: proto.Message.declinePaymentRequestMessage:type_name -> proto.DeclinePaymentRequestMessage - 86, // 105: proto.Message.cancelPaymentRequestMessage:type_name -> proto.CancelPaymentRequestMessage - 112, // 106: proto.Message.templateMessage:type_name -> proto.TemplateMessage - 115, // 107: proto.Message.stickerMessage:type_name -> proto.StickerMessage - 76, // 108: proto.Message.groupInviteMessage:type_name -> proto.GroupInviteMessage - 113, // 109: proto.Message.templateButtonReplyMessage:type_name -> proto.TemplateButtonReplyMessage - 122, // 110: proto.Message.productMessage:type_name -> proto.ProductMessage - 81, // 111: proto.Message.deviceSentMessage:type_name -> proto.DeviceSentMessage - 110, // 112: proto.Message.messageContextInfo:type_name -> proto.MessageContextInfo - 67, // 113: proto.Message.listMessage:type_name -> proto.ListMessage - 77, // 114: proto.Message.viewOnceMessage:type_name -> proto.FutureProofMessage - 63, // 115: proto.Message.orderMessage:type_name -> proto.OrderMessage - 66, // 116: proto.Message.listResponseMessage:type_name -> proto.ListResponseMessage - 77, // 117: proto.Message.ephemeralMessage:type_name -> proto.FutureProofMessage - 69, // 118: proto.Message.invoiceMessage:type_name -> proto.InvoiceMessage - 89, // 119: proto.Message.buttonsMessage:type_name -> proto.ButtonsMessage - 88, // 120: proto.Message.buttonsResponseMessage:type_name -> proto.ButtonsResponseMessage - 62, // 121: proto.Message.paymentInviteMessage:type_name -> proto.PaymentInviteMessage - 71, // 122: proto.Message.interactiveMessage:type_name -> proto.InteractiveMessage - 120, // 123: proto.Message.reactionMessage:type_name -> proto.ReactionMessage - 114, // 124: proto.Message.stickerSyncRmrMessage:type_name -> proto.StickerSyncRMRMessage - 70, // 125: proto.Message.interactiveResponseMessage:type_name -> proto.InteractiveResponseMessage - 127, // 126: proto.Message.pollCreationMessage:type_name -> proto.PollCreationMessage - 124, // 127: proto.Message.pollUpdateMessage:type_name -> proto.PollUpdateMessage - 68, // 128: proto.Message.keepInChatMessage:type_name -> proto.KeepInChatMessage - 77, // 129: proto.Message.documentWithCaptionMessage:type_name -> proto.FutureProofMessage - 118, // 130: proto.Message.requestPhoneNumberMessage:type_name -> proto.RequestPhoneNumberMessage - 77, // 131: proto.Message.viewOnceMessageV2:type_name -> proto.FutureProofMessage - 79, // 132: proto.Message.encReactionMessage:type_name -> proto.EncReactionMessage - 77, // 133: proto.Message.editedMessage:type_name -> proto.FutureProofMessage - 77, // 134: proto.Message.viewOnceMessageV2Extension:type_name -> proto.FutureProofMessage - 127, // 135: proto.Message.pollCreationMessageV2:type_name -> proto.PollCreationMessage - 102, // 136: proto.MessageContextInfo.deviceListMetadata:type_name -> proto.DeviceListMetadata - 99, // 137: proto.VideoMessage.interactiveAnnotations:type_name -> proto.InteractiveAnnotation - 103, // 138: proto.VideoMessage.contextInfo:type_name -> proto.ContextInfo - 25, // 139: proto.VideoMessage.gifAttribution:type_name -> proto.VideoMessage.Attribution - 103, // 140: proto.TemplateMessage.contextInfo:type_name -> proto.ContextInfo - 257, // 141: proto.TemplateMessage.hydratedTemplate:type_name -> proto.TemplateMessage.HydratedFourRowTemplate - 258, // 142: proto.TemplateMessage.fourRowTemplate:type_name -> proto.TemplateMessage.FourRowTemplate - 257, // 143: proto.TemplateMessage.hydratedFourRowTemplate:type_name -> proto.TemplateMessage.HydratedFourRowTemplate - 71, // 144: proto.TemplateMessage.interactiveMessageTemplate:type_name -> proto.InteractiveMessage - 103, // 145: proto.TemplateButtonReplyMessage.contextInfo:type_name -> proto.ContextInfo - 103, // 146: proto.StickerMessage.contextInfo:type_name -> proto.ContextInfo - 109, // 147: proto.SendPaymentMessage.noteMessage:type_name -> proto.Message - 145, // 148: proto.SendPaymentMessage.requestMessageKey:type_name -> proto.MessageKey - 107, // 149: proto.SendPaymentMessage.background:type_name -> proto.PaymentBackground - 103, // 150: proto.RequestPhoneNumberMessage.contextInfo:type_name -> proto.ContextInfo - 109, // 151: proto.RequestPaymentMessage.noteMessage:type_name -> proto.Message - 108, // 152: proto.RequestPaymentMessage.amount:type_name -> proto.Money - 107, // 153: proto.RequestPaymentMessage.background:type_name -> proto.PaymentBackground - 145, // 154: proto.ReactionMessage.key:type_name -> proto.MessageKey - 145, // 155: proto.ProtocolMessage.key:type_name -> proto.MessageKey - 26, // 156: proto.ProtocolMessage.type:type_name -> proto.ProtocolMessage.Type - 74, // 157: proto.ProtocolMessage.historySyncNotification:type_name -> proto.HistorySyncNotification - 92, // 158: proto.ProtocolMessage.appStateSyncKeyShare:type_name -> proto.AppStateSyncKeyShare - 93, // 159: proto.ProtocolMessage.appStateSyncKeyRequest:type_name -> proto.AppStateSyncKeyRequest - 72, // 160: proto.ProtocolMessage.initialSecurityNotificationSettingSync:type_name -> proto.InitialSecurityNotificationSettingSync - 97, // 161: proto.ProtocolMessage.appStateFatalExceptionNotification:type_name -> proto.AppStateFatalExceptionNotification - 101, // 162: proto.ProtocolMessage.disappearingMode:type_name -> proto.DisappearingMode - 109, // 163: proto.ProtocolMessage.editedMessage:type_name -> proto.Message - 61, // 164: proto.ProtocolMessage.peerDataOperationRequestMessage:type_name -> proto.PeerDataOperationRequestMessage - 60, // 165: proto.ProtocolMessage.peerDataOperationRequestResponseMessage:type_name -> proto.PeerDataOperationRequestResponseMessage - 259, // 166: proto.ProductMessage.product:type_name -> proto.ProductMessage.ProductSnapshot - 260, // 167: proto.ProductMessage.catalog:type_name -> proto.ProductMessage.CatalogSnapshot - 103, // 168: proto.ProductMessage.contextInfo:type_name -> proto.ContextInfo - 145, // 169: proto.PollUpdateMessage.pollCreationMessageKey:type_name -> proto.MessageKey - 126, // 170: proto.PollUpdateMessage.vote:type_name -> proto.PollEncValue - 125, // 171: proto.PollUpdateMessage.metadata:type_name -> proto.PollUpdateMessageMetadata - 261, // 172: proto.PollCreationMessage.options:type_name -> proto.PollCreationMessage.Option - 103, // 173: proto.PollCreationMessage.contextInfo:type_name -> proto.ContextInfo - 133, // 174: proto.PastParticipants.pastParticipants:type_name -> proto.PastParticipant - 27, // 175: proto.PastParticipant.leaveReason:type_name -> proto.PastParticipant.LeaveReason - 28, // 176: proto.HistorySync.syncType:type_name -> proto.HistorySync.HistorySyncType - 138, // 177: proto.HistorySync.conversations:type_name -> proto.Conversation - 204, // 178: proto.HistorySync.statusV3Messages:type_name -> proto.WebMessageInfo - 131, // 179: proto.HistorySync.pushnames:type_name -> proto.Pushname - 137, // 180: proto.HistorySync.globalSettings:type_name -> proto.GlobalSettings - 130, // 181: proto.HistorySync.recentStickers:type_name -> proto.StickerMetadata - 132, // 182: proto.HistorySync.pastParticipants:type_name -> proto.PastParticipants - 204, // 183: proto.HistorySyncMsg.message:type_name -> proto.WebMessageInfo - 29, // 184: proto.GroupParticipant.rank:type_name -> proto.GroupParticipant.Rank - 129, // 185: proto.GlobalSettings.lightThemeWallpaper:type_name -> proto.WallpaperSettings - 2, // 186: proto.GlobalSettings.mediaVisibility:type_name -> proto.MediaVisibility - 129, // 187: proto.GlobalSettings.darkThemeWallpaper:type_name -> proto.WallpaperSettings - 140, // 188: proto.GlobalSettings.autoDownloadWiFi:type_name -> proto.AutoDownloadSettings - 140, // 189: proto.GlobalSettings.autoDownloadCellular:type_name -> proto.AutoDownloadSettings - 140, // 190: proto.GlobalSettings.autoDownloadRoaming:type_name -> proto.AutoDownloadSettings - 139, // 191: proto.GlobalSettings.avatarUserSettings:type_name -> proto.AvatarUserSettings - 135, // 192: proto.Conversation.messages:type_name -> proto.HistorySyncMsg - 30, // 193: proto.Conversation.endOfHistoryTransferType:type_name -> proto.Conversation.EndOfHistoryTransferType - 101, // 194: proto.Conversation.disappearingMode:type_name -> proto.DisappearingMode - 136, // 195: proto.Conversation.participant:type_name -> proto.GroupParticipant - 129, // 196: proto.Conversation.wallpaper:type_name -> proto.WallpaperSettings - 2, // 197: proto.Conversation.mediaVisibility:type_name -> proto.MediaVisibility - 142, // 198: proto.MsgRowOpaqueData.currentMsg:type_name -> proto.MsgOpaqueData - 142, // 199: proto.MsgRowOpaqueData.quotedMsg:type_name -> proto.MsgOpaqueData - 262, // 200: proto.MsgOpaqueData.pollOptions:type_name -> proto.MsgOpaqueData.PollOption - 126, // 201: proto.MsgOpaqueData.encPollVote:type_name -> proto.PollEncValue - 31, // 202: proto.MediaRetryNotification.result:type_name -> proto.MediaRetryNotification.ResultType - 146, // 203: proto.SyncdSnapshot.version:type_name -> proto.SyncdVersion - 149, // 204: proto.SyncdSnapshot.records:type_name -> proto.SyncdRecord - 154, // 205: proto.SyncdSnapshot.keyId:type_name -> proto.KeyId - 153, // 206: proto.SyncdRecord.index:type_name -> proto.SyncdIndex - 147, // 207: proto.SyncdRecord.value:type_name -> proto.SyncdValue - 154, // 208: proto.SyncdRecord.keyId:type_name -> proto.KeyId - 146, // 209: proto.SyncdPatch.version:type_name -> proto.SyncdVersion - 152, // 210: proto.SyncdPatch.mutations:type_name -> proto.SyncdMutation - 155, // 211: proto.SyncdPatch.externalMutations:type_name -> proto.ExternalBlobReference - 154, // 212: proto.SyncdPatch.keyId:type_name -> proto.KeyId - 156, // 213: proto.SyncdPatch.exitCode:type_name -> proto.ExitCode - 152, // 214: proto.SyncdMutations.mutations:type_name -> proto.SyncdMutation - 32, // 215: proto.SyncdMutation.operation:type_name -> proto.SyncdMutation.SyncdOperation - 149, // 216: proto.SyncdMutation.record:type_name -> proto.SyncdRecord - 165, // 217: proto.SyncActionValue.starAction:type_name -> proto.StarAction - 184, // 218: proto.SyncActionValue.contactAction:type_name -> proto.ContactAction - 176, // 219: proto.SyncActionValue.muteAction:type_name -> proto.MuteAction - 174, // 220: proto.SyncActionValue.pinAction:type_name -> proto.PinAction - 166, // 221: proto.SyncActionValue.securityNotificationSetting:type_name -> proto.SecurityNotificationSetting - 170, // 222: proto.SyncActionValue.pushNameSetting:type_name -> proto.PushNameSetting - 169, // 223: proto.SyncActionValue.quickReplyAction:type_name -> proto.QuickReplyAction - 168, // 224: proto.SyncActionValue.recentEmojiWeightsAction:type_name -> proto.RecentEmojiWeightsAction - 179, // 225: proto.SyncActionValue.labelEditAction:type_name -> proto.LabelEditAction - 180, // 226: proto.SyncActionValue.labelAssociationAction:type_name -> proto.LabelAssociationAction - 178, // 227: proto.SyncActionValue.localeSetting:type_name -> proto.LocaleSetting - 188, // 228: proto.SyncActionValue.archiveChatAction:type_name -> proto.ArchiveChatAction - 182, // 229: proto.SyncActionValue.deleteMessageForMeAction:type_name -> proto.DeleteMessageForMeAction - 181, // 230: proto.SyncActionValue.keyExpiration:type_name -> proto.KeyExpiration - 177, // 231: proto.SyncActionValue.markChatAsReadAction:type_name -> proto.MarkChatAsReadAction - 185, // 232: proto.SyncActionValue.clearChatAction:type_name -> proto.ClearChatAction - 183, // 233: proto.SyncActionValue.deleteChatAction:type_name -> proto.DeleteChatAction - 159, // 234: proto.SyncActionValue.unarchiveChatsSetting:type_name -> proto.UnarchiveChatsSetting - 172, // 235: proto.SyncActionValue.primaryFeature:type_name -> proto.PrimaryFeature - 189, // 236: proto.SyncActionValue.androidUnsupportedActions:type_name -> proto.AndroidUnsupportedActions - 190, // 237: proto.SyncActionValue.agentAction:type_name -> proto.AgentAction - 163, // 238: proto.SyncActionValue.subscriptionAction:type_name -> proto.SubscriptionAction - 158, // 239: proto.SyncActionValue.userStatusMuteAction:type_name -> proto.UserStatusMuteAction - 160, // 240: proto.SyncActionValue.timeFormatAction:type_name -> proto.TimeFormatAction - 175, // 241: proto.SyncActionValue.nuxAction:type_name -> proto.NuxAction - 171, // 242: proto.SyncActionValue.primaryVersionAction:type_name -> proto.PrimaryVersionAction - 164, // 243: proto.SyncActionValue.stickerAction:type_name -> proto.StickerAction - 167, // 244: proto.SyncActionValue.removeRecentStickerAction:type_name -> proto.RemoveRecentStickerAction - 187, // 245: proto.SyncActionValue.chatAssignment:type_name -> proto.ChatAssignmentAction - 186, // 246: proto.SyncActionValue.chatAssignmentOpenedStatus:type_name -> proto.ChatAssignmentOpenedStatusAction - 173, // 247: proto.SyncActionValue.pnForLidChatAction:type_name -> proto.PnForLidChatAction - 145, // 248: proto.SyncActionMessage.key:type_name -> proto.MessageKey - 161, // 249: proto.SyncActionMessageRange.messages:type_name -> proto.SyncActionMessage - 192, // 250: proto.RecentEmojiWeightsAction.weights:type_name -> proto.RecentEmojiWeight - 162, // 251: proto.MarkChatAsReadAction.messageRange:type_name -> proto.SyncActionMessageRange - 162, // 252: proto.DeleteChatAction.messageRange:type_name -> proto.SyncActionMessageRange - 162, // 253: proto.ClearChatAction.messageRange:type_name -> proto.SyncActionMessageRange - 162, // 254: proto.ArchiveChatAction.messageRange:type_name -> proto.SyncActionMessageRange - 157, // 255: proto.SyncActionData.value:type_name -> proto.SyncActionValue - 33, // 256: proto.BizIdentityInfo.vlevel:type_name -> proto.BizIdentityInfo.VerifiedLevelValue - 193, // 257: proto.BizIdentityInfo.vnameCert:type_name -> proto.VerifiedNameCertificate - 34, // 258: proto.BizIdentityInfo.hostStorage:type_name -> proto.BizIdentityInfo.HostStorageType - 35, // 259: proto.BizIdentityInfo.actualActors:type_name -> proto.BizIdentityInfo.ActualActorsType - 193, // 260: proto.BizAccountPayload.vnameCert:type_name -> proto.VerifiedNameCertificate - 36, // 261: proto.BizAccountLinkInfo.hostStorage:type_name -> proto.BizAccountLinkInfo.HostStorageType - 37, // 262: proto.BizAccountLinkInfo.accountType:type_name -> proto.BizAccountLinkInfo.AccountType - 200, // 263: proto.HandshakeMessage.clientHello:type_name -> proto.HandshakeClientHello - 199, // 264: proto.HandshakeMessage.serverHello:type_name -> proto.HandshakeServerHello - 201, // 265: proto.HandshakeMessage.clientFinish:type_name -> proto.HandshakeClientFinish - 265, // 266: proto.ClientPayload.userAgent:type_name -> proto.ClientPayload.UserAgent - 264, // 267: proto.ClientPayload.webInfo:type_name -> proto.ClientPayload.WebInfo - 40, // 268: proto.ClientPayload.connectType:type_name -> proto.ClientPayload.ConnectType - 41, // 269: proto.ClientPayload.connectReason:type_name -> proto.ClientPayload.ConnectReason - 267, // 270: proto.ClientPayload.dnsSource:type_name -> proto.ClientPayload.DNSSource - 266, // 271: proto.ClientPayload.devicePairingData:type_name -> proto.ClientPayload.DevicePairingRegistrationData - 38, // 272: proto.ClientPayload.product:type_name -> proto.ClientPayload.Product - 39, // 273: proto.ClientPayload.iosAppExtension:type_name -> proto.ClientPayload.IOSAppExtension - 42, // 274: proto.ClientPayload.bizMarketSegment:type_name -> proto.ClientPayload.BizMarketSegment - 204, // 275: proto.WebNotificationsInfo.notifyMessages:type_name -> proto.WebMessageInfo - 145, // 276: proto.WebMessageInfo.key:type_name -> proto.MessageKey - 109, // 277: proto.WebMessageInfo.message:type_name -> proto.Message - 48, // 278: proto.WebMessageInfo.status:type_name -> proto.WebMessageInfo.Status - 47, // 279: proto.WebMessageInfo.messageStubType:type_name -> proto.WebMessageInfo.StubType - 212, // 280: proto.WebMessageInfo.paymentInfo:type_name -> proto.PaymentInfo - 65, // 281: proto.WebMessageInfo.finalLiveLocation:type_name -> proto.LiveLocationMessage - 212, // 282: proto.WebMessageInfo.quotedPaymentInfo:type_name -> proto.PaymentInfo - 49, // 283: proto.WebMessageInfo.bizPrivacyStatus:type_name -> proto.WebMessageInfo.BizPrivacyStatus - 214, // 284: proto.WebMessageInfo.mediaData:type_name -> proto.MediaData - 211, // 285: proto.WebMessageInfo.photoChange:type_name -> proto.PhotoChange - 206, // 286: proto.WebMessageInfo.userReceipt:type_name -> proto.UserReceipt - 208, // 287: proto.WebMessageInfo.reactions:type_name -> proto.Reaction - 214, // 288: proto.WebMessageInfo.quotedStickerData:type_name -> proto.MediaData - 207, // 289: proto.WebMessageInfo.statusPsa:type_name -> proto.StatusPSA - 209, // 290: proto.WebMessageInfo.pollUpdates:type_name -> proto.PollUpdate - 210, // 291: proto.WebMessageInfo.pollAdditionalMetadata:type_name -> proto.PollAdditionalMetadata - 215, // 292: proto.WebMessageInfo.keepInChat:type_name -> proto.KeepInChat - 50, // 293: proto.WebFeatures.labelsDisplay:type_name -> proto.WebFeatures.Flag - 50, // 294: proto.WebFeatures.voipIndividualOutgoing:type_name -> proto.WebFeatures.Flag - 50, // 295: proto.WebFeatures.groupsV3:type_name -> proto.WebFeatures.Flag - 50, // 296: proto.WebFeatures.groupsV3Create:type_name -> proto.WebFeatures.Flag - 50, // 297: proto.WebFeatures.changeNumberV2:type_name -> proto.WebFeatures.Flag - 50, // 298: proto.WebFeatures.queryStatusV3Thumbnail:type_name -> proto.WebFeatures.Flag - 50, // 299: proto.WebFeatures.liveLocations:type_name -> proto.WebFeatures.Flag - 50, // 300: proto.WebFeatures.queryVname:type_name -> proto.WebFeatures.Flag - 50, // 301: proto.WebFeatures.voipIndividualIncoming:type_name -> proto.WebFeatures.Flag - 50, // 302: proto.WebFeatures.quickRepliesQuery:type_name -> proto.WebFeatures.Flag - 50, // 303: proto.WebFeatures.payments:type_name -> proto.WebFeatures.Flag - 50, // 304: proto.WebFeatures.stickerPackQuery:type_name -> proto.WebFeatures.Flag - 50, // 305: proto.WebFeatures.liveLocationsFinal:type_name -> proto.WebFeatures.Flag - 50, // 306: proto.WebFeatures.labelsEdit:type_name -> proto.WebFeatures.Flag - 50, // 307: proto.WebFeatures.mediaUpload:type_name -> proto.WebFeatures.Flag - 50, // 308: proto.WebFeatures.mediaUploadRichQuickReplies:type_name -> proto.WebFeatures.Flag - 50, // 309: proto.WebFeatures.vnameV2:type_name -> proto.WebFeatures.Flag - 50, // 310: proto.WebFeatures.videoPlaybackUrl:type_name -> proto.WebFeatures.Flag - 50, // 311: proto.WebFeatures.statusRanking:type_name -> proto.WebFeatures.Flag - 50, // 312: proto.WebFeatures.voipIndividualVideo:type_name -> proto.WebFeatures.Flag - 50, // 313: proto.WebFeatures.thirdPartyStickers:type_name -> proto.WebFeatures.Flag - 50, // 314: proto.WebFeatures.frequentlyForwardedSetting:type_name -> proto.WebFeatures.Flag - 50, // 315: proto.WebFeatures.groupsV4JoinPermission:type_name -> proto.WebFeatures.Flag - 50, // 316: proto.WebFeatures.recentStickers:type_name -> proto.WebFeatures.Flag - 50, // 317: proto.WebFeatures.catalog:type_name -> proto.WebFeatures.Flag - 50, // 318: proto.WebFeatures.starredStickers:type_name -> proto.WebFeatures.Flag - 50, // 319: proto.WebFeatures.voipGroupCall:type_name -> proto.WebFeatures.Flag - 50, // 320: proto.WebFeatures.templateMessage:type_name -> proto.WebFeatures.Flag - 50, // 321: proto.WebFeatures.templateMessageInteractivity:type_name -> proto.WebFeatures.Flag - 50, // 322: proto.WebFeatures.ephemeralMessages:type_name -> proto.WebFeatures.Flag - 50, // 323: proto.WebFeatures.e2ENotificationSync:type_name -> proto.WebFeatures.Flag - 50, // 324: proto.WebFeatures.recentStickersV2:type_name -> proto.WebFeatures.Flag - 50, // 325: proto.WebFeatures.recentStickersV3:type_name -> proto.WebFeatures.Flag - 50, // 326: proto.WebFeatures.userNotice:type_name -> proto.WebFeatures.Flag - 50, // 327: proto.WebFeatures.support:type_name -> proto.WebFeatures.Flag - 50, // 328: proto.WebFeatures.groupUiiCleanup:type_name -> proto.WebFeatures.Flag - 50, // 329: proto.WebFeatures.groupDogfoodingInternalOnly:type_name -> proto.WebFeatures.Flag - 50, // 330: proto.WebFeatures.settingsSync:type_name -> proto.WebFeatures.Flag - 50, // 331: proto.WebFeatures.archiveV2:type_name -> proto.WebFeatures.Flag - 50, // 332: proto.WebFeatures.ephemeralAllowGroupMembers:type_name -> proto.WebFeatures.Flag - 50, // 333: proto.WebFeatures.ephemeral24HDuration:type_name -> proto.WebFeatures.Flag - 50, // 334: proto.WebFeatures.mdForceUpgrade:type_name -> proto.WebFeatures.Flag - 50, // 335: proto.WebFeatures.disappearingMode:type_name -> proto.WebFeatures.Flag - 50, // 336: proto.WebFeatures.externalMdOptInAvailable:type_name -> proto.WebFeatures.Flag - 50, // 337: proto.WebFeatures.noDeleteMessageTimeLimit:type_name -> proto.WebFeatures.Flag - 145, // 338: proto.Reaction.key:type_name -> proto.MessageKey - 145, // 339: proto.PollUpdate.pollUpdateMessageKey:type_name -> proto.MessageKey - 123, // 340: proto.PollUpdate.vote:type_name -> proto.PollVoteMessage - 53, // 341: proto.PaymentInfo.currencyDeprecated:type_name -> proto.PaymentInfo.Currency - 52, // 342: proto.PaymentInfo.status:type_name -> proto.PaymentInfo.Status - 145, // 343: proto.PaymentInfo.requestMessageKey:type_name -> proto.MessageKey - 51, // 344: proto.PaymentInfo.txnStatus:type_name -> proto.PaymentInfo.TxnStatus - 108, // 345: proto.PaymentInfo.primaryAmount:type_name -> proto.Money - 108, // 346: proto.PaymentInfo.exchangeAmount:type_name -> proto.Money - 145, // 347: proto.NotificationMessageInfo.key:type_name -> proto.MessageKey - 109, // 348: proto.NotificationMessageInfo.message:type_name -> proto.Message - 1, // 349: proto.KeepInChat.keepType:type_name -> proto.KeepType - 145, // 350: proto.KeepInChat.key:type_name -> proto.MessageKey - 271, // 351: proto.CertChain.leaf:type_name -> proto.CertChain.NoiseCertificate - 271, // 352: proto.CertChain.intermediate:type_name -> proto.CertChain.NoiseCertificate - 31, // 353: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.mediaUploadResult:type_name -> proto.MediaRetryNotification.ResultType - 115, // 354: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.stickerMessage:type_name -> proto.StickerMessage - 221, // 355: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.linkPreviewResponse:type_name -> proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.LinkPreviewResponse - 226, // 356: proto.ListMessage.Section.rows:type_name -> proto.ListMessage.Row - 227, // 357: proto.ListMessage.ProductSection.products:type_name -> proto.ListMessage.Product - 228, // 358: proto.ListMessage.ProductListInfo.productSections:type_name -> proto.ListMessage.ProductSection - 230, // 359: proto.ListMessage.ProductListInfo.headerImage:type_name -> proto.ListMessage.ProductListHeaderImage - 10, // 360: proto.InteractiveMessage.ShopMessage.surface:type_name -> proto.InteractiveMessage.ShopMessage.Surface - 239, // 361: proto.InteractiveMessage.NativeFlowMessage.buttons:type_name -> proto.InteractiveMessage.NativeFlowMessage.NativeFlowButton - 80, // 362: proto.InteractiveMessage.Header.documentMessage:type_name -> proto.DocumentMessage - 73, // 363: proto.InteractiveMessage.Header.imageMessage:type_name -> proto.ImageMessage - 111, // 364: proto.InteractiveMessage.Header.videoMessage:type_name -> proto.VideoMessage - 242, // 365: proto.HighlyStructuredMessage.HSMLocalizableParameter.currency:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMCurrency - 241, // 366: proto.HighlyStructuredMessage.HSMLocalizableParameter.dateTime:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime - 244, // 367: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.component:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent - 243, // 368: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.unixEpoch:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeUnixEpoch - 12, // 369: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.dayOfWeek:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.DayOfWeekType - 13, // 370: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.calendar:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.CalendarType - 247, // 371: proto.ButtonsMessage.Button.buttonText:type_name -> proto.ButtonsMessage.Button.ButtonText - 20, // 372: proto.ButtonsMessage.Button.type:type_name -> proto.ButtonsMessage.Button.Type - 246, // 373: proto.ButtonsMessage.Button.nativeFlowInfo:type_name -> proto.ButtonsMessage.Button.NativeFlowInfo - 22, // 374: proto.ContextInfo.ExternalAdReplyInfo.mediaType:type_name -> proto.ContextInfo.ExternalAdReplyInfo.MediaType - 23, // 375: proto.ContextInfo.AdReplyInfo.mediaType:type_name -> proto.ContextInfo.AdReplyInfo.MediaType - 75, // 376: proto.TemplateButton.URLButton.displayText:type_name -> proto.HighlyStructuredMessage - 75, // 377: proto.TemplateButton.URLButton.url:type_name -> proto.HighlyStructuredMessage - 75, // 378: proto.TemplateButton.QuickReplyButton.displayText:type_name -> proto.HighlyStructuredMessage - 75, // 379: proto.TemplateButton.CallButton.displayText:type_name -> proto.HighlyStructuredMessage - 75, // 380: proto.TemplateButton.CallButton.phoneNumber:type_name -> proto.HighlyStructuredMessage - 100, // 381: proto.TemplateMessage.HydratedFourRowTemplate.hydratedButtons:type_name -> proto.HydratedTemplateButton - 80, // 382: proto.TemplateMessage.HydratedFourRowTemplate.documentMessage:type_name -> proto.DocumentMessage - 73, // 383: proto.TemplateMessage.HydratedFourRowTemplate.imageMessage:type_name -> proto.ImageMessage - 111, // 384: proto.TemplateMessage.HydratedFourRowTemplate.videoMessage:type_name -> proto.VideoMessage - 64, // 385: proto.TemplateMessage.HydratedFourRowTemplate.locationMessage:type_name -> proto.LocationMessage - 75, // 386: proto.TemplateMessage.FourRowTemplate.content:type_name -> proto.HighlyStructuredMessage - 75, // 387: proto.TemplateMessage.FourRowTemplate.footer:type_name -> proto.HighlyStructuredMessage - 105, // 388: proto.TemplateMessage.FourRowTemplate.buttons:type_name -> proto.TemplateButton - 80, // 389: proto.TemplateMessage.FourRowTemplate.documentMessage:type_name -> proto.DocumentMessage - 75, // 390: proto.TemplateMessage.FourRowTemplate.highlyStructuredMessage:type_name -> proto.HighlyStructuredMessage - 73, // 391: proto.TemplateMessage.FourRowTemplate.imageMessage:type_name -> proto.ImageMessage - 111, // 392: proto.TemplateMessage.FourRowTemplate.videoMessage:type_name -> proto.VideoMessage - 64, // 393: proto.TemplateMessage.FourRowTemplate.locationMessage:type_name -> proto.LocationMessage - 73, // 394: proto.ProductMessage.ProductSnapshot.productImage:type_name -> proto.ImageMessage - 73, // 395: proto.ProductMessage.CatalogSnapshot.catalogImage:type_name -> proto.ImageMessage - 194, // 396: proto.VerifiedNameCertificate.Details.localizedNames:type_name -> proto.LocalizedName - 268, // 397: proto.ClientPayload.WebInfo.webdPayload:type_name -> proto.ClientPayload.WebInfo.WebdPayload - 43, // 398: proto.ClientPayload.WebInfo.webSubPlatform:type_name -> proto.ClientPayload.WebInfo.WebSubPlatform - 45, // 399: proto.ClientPayload.UserAgent.platform:type_name -> proto.ClientPayload.UserAgent.Platform - 269, // 400: proto.ClientPayload.UserAgent.appVersion:type_name -> proto.ClientPayload.UserAgent.AppVersion - 44, // 401: proto.ClientPayload.UserAgent.releaseChannel:type_name -> proto.ClientPayload.UserAgent.ReleaseChannel - 46, // 402: proto.ClientPayload.DNSSource.dnsMethod:type_name -> proto.ClientPayload.DNSSource.DNSResolutionMethod - 403, // [403:403] is the sub-list for method output_type - 403, // [403:403] is the sub-list for method input_type - 403, // [403:403] is the sub-list for extension type_name - 403, // [403:403] is the sub-list for extension extendee - 0, // [0:403] is the sub-list for field type_name + 224, // 2: proto.DeviceProps.historySyncConfig:type_name -> proto.DeviceProps.HistorySyncConfig + 1, // 3: proto.PeerDataOperationRequestMessage.peerDataOperationRequestType:type_name -> proto.PeerDataOperationRequestType + 227, // 4: proto.PeerDataOperationRequestMessage.requestStickerReupload:type_name -> proto.PeerDataOperationRequestMessage.RequestStickerReupload + 226, // 5: proto.PeerDataOperationRequestMessage.requestUrlPreview:type_name -> proto.PeerDataOperationRequestMessage.RequestUrlPreview + 228, // 6: proto.PeerDataOperationRequestMessage.historySyncOnDemandRequest:type_name -> proto.PeerDataOperationRequestMessage.HistorySyncOnDemandRequest + 4, // 7: proto.PaymentInviteMessage.serviceType:type_name -> proto.PaymentInviteMessage.ServiceType + 6, // 8: proto.OrderMessage.status:type_name -> proto.OrderMessage.OrderStatus + 5, // 9: proto.OrderMessage.surface:type_name -> proto.OrderMessage.OrderSurface + 105, // 10: proto.OrderMessage.contextInfo:type_name -> proto.ContextInfo + 105, // 11: proto.LocationMessage.contextInfo:type_name -> proto.ContextInfo + 105, // 12: proto.LiveLocationMessage.contextInfo:type_name -> proto.ContextInfo + 7, // 13: proto.ListResponseMessage.listType:type_name -> proto.ListResponseMessage.ListType + 229, // 14: proto.ListResponseMessage.singleSelectReply:type_name -> proto.ListResponseMessage.SingleSelectReply + 105, // 15: proto.ListResponseMessage.contextInfo:type_name -> proto.ContextInfo + 8, // 16: proto.ListMessage.listType:type_name -> proto.ListMessage.ListType + 230, // 17: proto.ListMessage.sections:type_name -> proto.ListMessage.Section + 234, // 18: proto.ListMessage.productListInfo:type_name -> proto.ListMessage.ProductListInfo + 105, // 19: proto.ListMessage.contextInfo:type_name -> proto.ContextInfo + 151, // 20: proto.KeepInChatMessage.key:type_name -> proto.MessageKey + 0, // 21: proto.KeepInChatMessage.keepType:type_name -> proto.KeepType + 9, // 22: proto.InvoiceMessage.attachmentType:type_name -> proto.InvoiceMessage.AttachmentType + 237, // 23: proto.InteractiveResponseMessage.body:type_name -> proto.InteractiveResponseMessage.Body + 105, // 24: proto.InteractiveResponseMessage.contextInfo:type_name -> proto.ContextInfo + 236, // 25: proto.InteractiveResponseMessage.nativeFlowResponseMessage:type_name -> proto.InteractiveResponseMessage.NativeFlowResponseMessage + 240, // 26: proto.InteractiveMessage.header:type_name -> proto.InteractiveMessage.Header + 243, // 27: proto.InteractiveMessage.body:type_name -> proto.InteractiveMessage.Body + 241, // 28: proto.InteractiveMessage.footer:type_name -> proto.InteractiveMessage.Footer + 105, // 29: proto.InteractiveMessage.contextInfo:type_name -> proto.ContextInfo + 238, // 30: proto.InteractiveMessage.shopStorefrontMessage:type_name -> proto.InteractiveMessage.ShopMessage + 242, // 31: proto.InteractiveMessage.collectionMessage:type_name -> proto.InteractiveMessage.CollectionMessage + 239, // 32: proto.InteractiveMessage.nativeFlowMessage:type_name -> proto.InteractiveMessage.NativeFlowMessage + 100, // 33: proto.ImageMessage.interactiveAnnotations:type_name -> proto.InteractiveAnnotation + 105, // 34: proto.ImageMessage.contextInfo:type_name -> proto.ContextInfo + 11, // 35: proto.HistorySyncNotification.syncType:type_name -> proto.HistorySyncNotification.HistorySyncType + 245, // 36: proto.HighlyStructuredMessage.localizableParams:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter + 114, // 37: proto.HighlyStructuredMessage.hydratedHsm:type_name -> proto.TemplateMessage + 105, // 38: proto.GroupInviteMessage.contextInfo:type_name -> proto.ContextInfo + 14, // 39: proto.GroupInviteMessage.groupType:type_name -> proto.GroupInviteMessage.GroupType + 111, // 40: proto.FutureProofMessage.message:type_name -> proto.Message + 17, // 41: proto.ExtendedTextMessage.font:type_name -> proto.ExtendedTextMessage.FontType + 15, // 42: proto.ExtendedTextMessage.previewType:type_name -> proto.ExtendedTextMessage.PreviewType + 105, // 43: proto.ExtendedTextMessage.contextInfo:type_name -> proto.ContextInfo + 16, // 44: proto.ExtendedTextMessage.inviteLinkGroupType:type_name -> proto.ExtendedTextMessage.InviteLinkGroupType + 16, // 45: proto.ExtendedTextMessage.inviteLinkGroupTypeV2:type_name -> proto.ExtendedTextMessage.InviteLinkGroupType + 151, // 46: proto.EncReactionMessage.targetMessageKey:type_name -> proto.MessageKey + 105, // 47: proto.DocumentMessage.contextInfo:type_name -> proto.ContextInfo + 111, // 48: proto.DeviceSentMessage.message:type_name -> proto.Message + 151, // 49: proto.DeclinePaymentRequestMessage.key:type_name -> proto.MessageKey + 85, // 50: proto.ContactsArrayMessage.contacts:type_name -> proto.ContactMessage + 105, // 51: proto.ContactsArrayMessage.contextInfo:type_name -> proto.ContextInfo + 105, // 52: proto.ContactMessage.contextInfo:type_name -> proto.ContextInfo + 151, // 53: proto.CancelPaymentRequestMessage.key:type_name -> proto.MessageKey + 105, // 54: proto.ButtonsResponseMessage.contextInfo:type_name -> proto.ContextInfo + 18, // 55: proto.ButtonsResponseMessage.type:type_name -> proto.ButtonsResponseMessage.Type + 105, // 56: proto.ButtonsMessage.contextInfo:type_name -> proto.ContextInfo + 250, // 57: proto.ButtonsMessage.buttons:type_name -> proto.ButtonsMessage.Button + 19, // 58: proto.ButtonsMessage.headerType:type_name -> proto.ButtonsMessage.HeaderType + 81, // 59: proto.ButtonsMessage.documentMessage:type_name -> proto.DocumentMessage + 74, // 60: proto.ButtonsMessage.imageMessage:type_name -> proto.ImageMessage + 113, // 61: proto.ButtonsMessage.videoMessage:type_name -> proto.VideoMessage + 65, // 62: proto.ButtonsMessage.locationMessage:type_name -> proto.LocationMessage + 105, // 63: proto.AudioMessage.contextInfo:type_name -> proto.ContextInfo + 95, // 64: proto.AppStateSyncKey.keyId:type_name -> proto.AppStateSyncKeyId + 97, // 65: proto.AppStateSyncKey.keyData:type_name -> proto.AppStateSyncKeyData + 92, // 66: proto.AppStateSyncKeyShare.keys:type_name -> proto.AppStateSyncKey + 95, // 67: proto.AppStateSyncKeyRequest.keyIds:type_name -> proto.AppStateSyncKeyId + 96, // 68: proto.AppStateSyncKeyData.fingerprint:type_name -> proto.AppStateSyncKeyFingerprint + 108, // 69: proto.InteractiveAnnotation.polygonVertices:type_name -> proto.Point + 99, // 70: proto.InteractiveAnnotation.location:type_name -> proto.Location + 254, // 71: proto.HydratedTemplateButton.quickReplyButton:type_name -> proto.HydratedTemplateButton.HydratedQuickReplyButton + 253, // 72: proto.HydratedTemplateButton.urlButton:type_name -> proto.HydratedTemplateButton.HydratedURLButton + 255, // 73: proto.HydratedTemplateButton.callButton:type_name -> proto.HydratedTemplateButton.HydratedCallButton + 21, // 74: proto.DisappearingMode.initiator:type_name -> proto.DisappearingMode.Initiator + 111, // 75: proto.ContextInfo.quotedMessage:type_name -> proto.Message + 258, // 76: proto.ContextInfo.quotedAd:type_name -> proto.ContextInfo.AdReplyInfo + 151, // 77: proto.ContextInfo.placeholderKey:type_name -> proto.MessageKey + 257, // 78: proto.ContextInfo.externalAdReply:type_name -> proto.ContextInfo.ExternalAdReplyInfo + 103, // 79: proto.ContextInfo.disappearingMode:type_name -> proto.DisappearingMode + 106, // 80: proto.ContextInfo.actionLink:type_name -> proto.ActionLink + 102, // 81: proto.ContextInfo.groupMentions:type_name -> proto.GroupMention + 256, // 82: proto.ContextInfo.utm:type_name -> proto.ContextInfo.UTMInfo + 260, // 83: proto.TemplateButton.quickReplyButton:type_name -> proto.TemplateButton.QuickReplyButton + 259, // 84: proto.TemplateButton.urlButton:type_name -> proto.TemplateButton.URLButton + 261, // 85: proto.TemplateButton.callButton:type_name -> proto.TemplateButton.CallButton + 262, // 86: proto.PaymentBackground.mediaData:type_name -> proto.PaymentBackground.MediaData + 24, // 87: proto.PaymentBackground.type:type_name -> proto.PaymentBackground.Type + 118, // 88: proto.Message.senderKeyDistributionMessage:type_name -> proto.SenderKeyDistributionMessage + 74, // 89: proto.Message.imageMessage:type_name -> proto.ImageMessage + 85, // 90: proto.Message.contactMessage:type_name -> proto.ContactMessage + 65, // 91: proto.Message.locationMessage:type_name -> proto.LocationMessage + 79, // 92: proto.Message.extendedTextMessage:type_name -> proto.ExtendedTextMessage + 81, // 93: proto.Message.documentMessage:type_name -> proto.DocumentMessage + 91, // 94: proto.Message.audioMessage:type_name -> proto.AudioMessage + 113, // 95: proto.Message.videoMessage:type_name -> proto.VideoMessage + 88, // 96: proto.Message.call:type_name -> proto.Call + 86, // 97: proto.Message.chat:type_name -> proto.Chat + 125, // 98: proto.Message.protocolMessage:type_name -> proto.ProtocolMessage + 84, // 99: proto.Message.contactsArrayMessage:type_name -> proto.ContactsArrayMessage + 76, // 100: proto.Message.highlyStructuredMessage:type_name -> proto.HighlyStructuredMessage + 118, // 101: proto.Message.fastRatchetKeySenderKeyDistributionMessage:type_name -> proto.SenderKeyDistributionMessage + 119, // 102: proto.Message.sendPaymentMessage:type_name -> proto.SendPaymentMessage + 66, // 103: proto.Message.liveLocationMessage:type_name -> proto.LiveLocationMessage + 123, // 104: proto.Message.requestPaymentMessage:type_name -> proto.RequestPaymentMessage + 83, // 105: proto.Message.declinePaymentRequestMessage:type_name -> proto.DeclinePaymentRequestMessage + 87, // 106: proto.Message.cancelPaymentRequestMessage:type_name -> proto.CancelPaymentRequestMessage + 114, // 107: proto.Message.templateMessage:type_name -> proto.TemplateMessage + 117, // 108: proto.Message.stickerMessage:type_name -> proto.StickerMessage + 77, // 109: proto.Message.groupInviteMessage:type_name -> proto.GroupInviteMessage + 115, // 110: proto.Message.templateButtonReplyMessage:type_name -> proto.TemplateButtonReplyMessage + 126, // 111: proto.Message.productMessage:type_name -> proto.ProductMessage + 82, // 112: proto.Message.deviceSentMessage:type_name -> proto.DeviceSentMessage + 112, // 113: proto.Message.messageContextInfo:type_name -> proto.MessageContextInfo + 68, // 114: proto.Message.listMessage:type_name -> proto.ListMessage + 78, // 115: proto.Message.viewOnceMessage:type_name -> proto.FutureProofMessage + 64, // 116: proto.Message.orderMessage:type_name -> proto.OrderMessage + 67, // 117: proto.Message.listResponseMessage:type_name -> proto.ListResponseMessage + 78, // 118: proto.Message.ephemeralMessage:type_name -> proto.FutureProofMessage + 70, // 119: proto.Message.invoiceMessage:type_name -> proto.InvoiceMessage + 90, // 120: proto.Message.buttonsMessage:type_name -> proto.ButtonsMessage + 89, // 121: proto.Message.buttonsResponseMessage:type_name -> proto.ButtonsResponseMessage + 63, // 122: proto.Message.paymentInviteMessage:type_name -> proto.PaymentInviteMessage + 72, // 123: proto.Message.interactiveMessage:type_name -> proto.InteractiveMessage + 124, // 124: proto.Message.reactionMessage:type_name -> proto.ReactionMessage + 116, // 125: proto.Message.stickerSyncRmrMessage:type_name -> proto.StickerSyncRMRMessage + 71, // 126: proto.Message.interactiveResponseMessage:type_name -> proto.InteractiveResponseMessage + 131, // 127: proto.Message.pollCreationMessage:type_name -> proto.PollCreationMessage + 128, // 128: proto.Message.pollUpdateMessage:type_name -> proto.PollUpdateMessage + 69, // 129: proto.Message.keepInChatMessage:type_name -> proto.KeepInChatMessage + 78, // 130: proto.Message.documentWithCaptionMessage:type_name -> proto.FutureProofMessage + 122, // 131: proto.Message.requestPhoneNumberMessage:type_name -> proto.RequestPhoneNumberMessage + 78, // 132: proto.Message.viewOnceMessageV2:type_name -> proto.FutureProofMessage + 80, // 133: proto.Message.encReactionMessage:type_name -> proto.EncReactionMessage + 78, // 134: proto.Message.editedMessage:type_name -> proto.FutureProofMessage + 78, // 135: proto.Message.viewOnceMessageV2Extension:type_name -> proto.FutureProofMessage + 131, // 136: proto.Message.pollCreationMessageV2:type_name -> proto.PollCreationMessage + 121, // 137: proto.Message.scheduledCallCreationMessage:type_name -> proto.ScheduledCallCreationMessage + 78, // 138: proto.Message.groupMentionedMessage:type_name -> proto.FutureProofMessage + 132, // 139: proto.Message.pinMessage:type_name -> proto.PinMessage + 131, // 140: proto.Message.pollCreationMessageV3:type_name -> proto.PollCreationMessage + 120, // 141: proto.Message.scheduledCallEditMessage:type_name -> proto.ScheduledCallEditMessage + 113, // 142: proto.Message.ptvMessage:type_name -> proto.VideoMessage + 104, // 143: proto.MessageContextInfo.deviceListMetadata:type_name -> proto.DeviceListMetadata + 100, // 144: proto.VideoMessage.interactiveAnnotations:type_name -> proto.InteractiveAnnotation + 105, // 145: proto.VideoMessage.contextInfo:type_name -> proto.ContextInfo + 25, // 146: proto.VideoMessage.gifAttribution:type_name -> proto.VideoMessage.Attribution + 105, // 147: proto.TemplateMessage.contextInfo:type_name -> proto.ContextInfo + 263, // 148: proto.TemplateMessage.hydratedTemplate:type_name -> proto.TemplateMessage.HydratedFourRowTemplate + 264, // 149: proto.TemplateMessage.fourRowTemplate:type_name -> proto.TemplateMessage.FourRowTemplate + 263, // 150: proto.TemplateMessage.hydratedFourRowTemplate:type_name -> proto.TemplateMessage.HydratedFourRowTemplate + 72, // 151: proto.TemplateMessage.interactiveMessageTemplate:type_name -> proto.InteractiveMessage + 105, // 152: proto.TemplateButtonReplyMessage.contextInfo:type_name -> proto.ContextInfo + 105, // 153: proto.StickerMessage.contextInfo:type_name -> proto.ContextInfo + 111, // 154: proto.SendPaymentMessage.noteMessage:type_name -> proto.Message + 151, // 155: proto.SendPaymentMessage.requestMessageKey:type_name -> proto.MessageKey + 109, // 156: proto.SendPaymentMessage.background:type_name -> proto.PaymentBackground + 151, // 157: proto.ScheduledCallEditMessage.key:type_name -> proto.MessageKey + 26, // 158: proto.ScheduledCallEditMessage.editType:type_name -> proto.ScheduledCallEditMessage.EditType + 27, // 159: proto.ScheduledCallCreationMessage.callType:type_name -> proto.ScheduledCallCreationMessage.CallType + 105, // 160: proto.RequestPhoneNumberMessage.contextInfo:type_name -> proto.ContextInfo + 111, // 161: proto.RequestPaymentMessage.noteMessage:type_name -> proto.Message + 110, // 162: proto.RequestPaymentMessage.amount:type_name -> proto.Money + 109, // 163: proto.RequestPaymentMessage.background:type_name -> proto.PaymentBackground + 151, // 164: proto.ReactionMessage.key:type_name -> proto.MessageKey + 151, // 165: proto.ProtocolMessage.key:type_name -> proto.MessageKey + 28, // 166: proto.ProtocolMessage.type:type_name -> proto.ProtocolMessage.Type + 75, // 167: proto.ProtocolMessage.historySyncNotification:type_name -> proto.HistorySyncNotification + 93, // 168: proto.ProtocolMessage.appStateSyncKeyShare:type_name -> proto.AppStateSyncKeyShare + 94, // 169: proto.ProtocolMessage.appStateSyncKeyRequest:type_name -> proto.AppStateSyncKeyRequest + 73, // 170: proto.ProtocolMessage.initialSecurityNotificationSettingSync:type_name -> proto.InitialSecurityNotificationSettingSync + 98, // 171: proto.ProtocolMessage.appStateFatalExceptionNotification:type_name -> proto.AppStateFatalExceptionNotification + 103, // 172: proto.ProtocolMessage.disappearingMode:type_name -> proto.DisappearingMode + 111, // 173: proto.ProtocolMessage.editedMessage:type_name -> proto.Message + 62, // 174: proto.ProtocolMessage.peerDataOperationRequestMessage:type_name -> proto.PeerDataOperationRequestMessage + 133, // 175: proto.ProtocolMessage.peerDataOperationRequestResponseMessage:type_name -> proto.PeerDataOperationRequestResponseMessage + 265, // 176: proto.ProductMessage.product:type_name -> proto.ProductMessage.ProductSnapshot + 266, // 177: proto.ProductMessage.catalog:type_name -> proto.ProductMessage.CatalogSnapshot + 105, // 178: proto.ProductMessage.contextInfo:type_name -> proto.ContextInfo + 151, // 179: proto.PollUpdateMessage.pollCreationMessageKey:type_name -> proto.MessageKey + 130, // 180: proto.PollUpdateMessage.vote:type_name -> proto.PollEncValue + 129, // 181: proto.PollUpdateMessage.metadata:type_name -> proto.PollUpdateMessageMetadata + 267, // 182: proto.PollCreationMessage.options:type_name -> proto.PollCreationMessage.Option + 105, // 183: proto.PollCreationMessage.contextInfo:type_name -> proto.ContextInfo + 151, // 184: proto.PinMessage.key:type_name -> proto.MessageKey + 29, // 185: proto.PinMessage.pinMessageType:type_name -> proto.PinMessage.PinMessageType + 1, // 186: proto.PeerDataOperationRequestResponseMessage.peerDataOperationRequestType:type_name -> proto.PeerDataOperationRequestType + 268, // 187: proto.PeerDataOperationRequestResponseMessage.peerDataOperationResult:type_name -> proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult + 139, // 188: proto.PastParticipants.pastParticipants:type_name -> proto.PastParticipant + 30, // 189: proto.PastParticipant.leaveReason:type_name -> proto.PastParticipant.LeaveReason + 31, // 190: proto.HistorySync.syncType:type_name -> proto.HistorySync.HistorySyncType + 144, // 191: proto.HistorySync.conversations:type_name -> proto.Conversation + 210, // 192: proto.HistorySync.statusV3Messages:type_name -> proto.WebMessageInfo + 137, // 193: proto.HistorySync.pushnames:type_name -> proto.Pushname + 143, // 194: proto.HistorySync.globalSettings:type_name -> proto.GlobalSettings + 136, // 195: proto.HistorySync.recentStickers:type_name -> proto.StickerMetadata + 138, // 196: proto.HistorySync.pastParticipants:type_name -> proto.PastParticipants + 210, // 197: proto.HistorySyncMsg.message:type_name -> proto.WebMessageInfo + 32, // 198: proto.GroupParticipant.rank:type_name -> proto.GroupParticipant.Rank + 135, // 199: proto.GlobalSettings.lightThemeWallpaper:type_name -> proto.WallpaperSettings + 2, // 200: proto.GlobalSettings.mediaVisibility:type_name -> proto.MediaVisibility + 135, // 201: proto.GlobalSettings.darkThemeWallpaper:type_name -> proto.WallpaperSettings + 146, // 202: proto.GlobalSettings.autoDownloadWiFi:type_name -> proto.AutoDownloadSettings + 146, // 203: proto.GlobalSettings.autoDownloadCellular:type_name -> proto.AutoDownloadSettings + 146, // 204: proto.GlobalSettings.autoDownloadRoaming:type_name -> proto.AutoDownloadSettings + 145, // 205: proto.GlobalSettings.avatarUserSettings:type_name -> proto.AvatarUserSettings + 141, // 206: proto.Conversation.messages:type_name -> proto.HistorySyncMsg + 33, // 207: proto.Conversation.endOfHistoryTransferType:type_name -> proto.Conversation.EndOfHistoryTransferType + 103, // 208: proto.Conversation.disappearingMode:type_name -> proto.DisappearingMode + 142, // 209: proto.Conversation.participant:type_name -> proto.GroupParticipant + 135, // 210: proto.Conversation.wallpaper:type_name -> proto.WallpaperSettings + 2, // 211: proto.Conversation.mediaVisibility:type_name -> proto.MediaVisibility + 148, // 212: proto.MsgRowOpaqueData.currentMsg:type_name -> proto.MsgOpaqueData + 148, // 213: proto.MsgRowOpaqueData.quotedMsg:type_name -> proto.MsgOpaqueData + 270, // 214: proto.MsgOpaqueData.pollOptions:type_name -> proto.MsgOpaqueData.PollOption + 130, // 215: proto.MsgOpaqueData.encPollVote:type_name -> proto.PollEncValue + 34, // 216: proto.MediaRetryNotification.result:type_name -> proto.MediaRetryNotification.ResultType + 152, // 217: proto.SyncdSnapshot.version:type_name -> proto.SyncdVersion + 155, // 218: proto.SyncdSnapshot.records:type_name -> proto.SyncdRecord + 160, // 219: proto.SyncdSnapshot.keyId:type_name -> proto.KeyId + 159, // 220: proto.SyncdRecord.index:type_name -> proto.SyncdIndex + 153, // 221: proto.SyncdRecord.value:type_name -> proto.SyncdValue + 160, // 222: proto.SyncdRecord.keyId:type_name -> proto.KeyId + 152, // 223: proto.SyncdPatch.version:type_name -> proto.SyncdVersion + 158, // 224: proto.SyncdPatch.mutations:type_name -> proto.SyncdMutation + 161, // 225: proto.SyncdPatch.externalMutations:type_name -> proto.ExternalBlobReference + 160, // 226: proto.SyncdPatch.keyId:type_name -> proto.KeyId + 162, // 227: proto.SyncdPatch.exitCode:type_name -> proto.ExitCode + 158, // 228: proto.SyncdMutations.mutations:type_name -> proto.SyncdMutation + 35, // 229: proto.SyncdMutation.operation:type_name -> proto.SyncdMutation.SyncdOperation + 155, // 230: proto.SyncdMutation.record:type_name -> proto.SyncdRecord + 171, // 231: proto.SyncActionValue.starAction:type_name -> proto.StarAction + 190, // 232: proto.SyncActionValue.contactAction:type_name -> proto.ContactAction + 182, // 233: proto.SyncActionValue.muteAction:type_name -> proto.MuteAction + 180, // 234: proto.SyncActionValue.pinAction:type_name -> proto.PinAction + 172, // 235: proto.SyncActionValue.securityNotificationSetting:type_name -> proto.SecurityNotificationSetting + 176, // 236: proto.SyncActionValue.pushNameSetting:type_name -> proto.PushNameSetting + 175, // 237: proto.SyncActionValue.quickReplyAction:type_name -> proto.QuickReplyAction + 174, // 238: proto.SyncActionValue.recentEmojiWeightsAction:type_name -> proto.RecentEmojiWeightsAction + 185, // 239: proto.SyncActionValue.labelEditAction:type_name -> proto.LabelEditAction + 186, // 240: proto.SyncActionValue.labelAssociationAction:type_name -> proto.LabelAssociationAction + 184, // 241: proto.SyncActionValue.localeSetting:type_name -> proto.LocaleSetting + 194, // 242: proto.SyncActionValue.archiveChatAction:type_name -> proto.ArchiveChatAction + 188, // 243: proto.SyncActionValue.deleteMessageForMeAction:type_name -> proto.DeleteMessageForMeAction + 187, // 244: proto.SyncActionValue.keyExpiration:type_name -> proto.KeyExpiration + 183, // 245: proto.SyncActionValue.markChatAsReadAction:type_name -> proto.MarkChatAsReadAction + 191, // 246: proto.SyncActionValue.clearChatAction:type_name -> proto.ClearChatAction + 189, // 247: proto.SyncActionValue.deleteChatAction:type_name -> proto.DeleteChatAction + 165, // 248: proto.SyncActionValue.unarchiveChatsSetting:type_name -> proto.UnarchiveChatsSetting + 178, // 249: proto.SyncActionValue.primaryFeature:type_name -> proto.PrimaryFeature + 195, // 250: proto.SyncActionValue.androidUnsupportedActions:type_name -> proto.AndroidUnsupportedActions + 196, // 251: proto.SyncActionValue.agentAction:type_name -> proto.AgentAction + 169, // 252: proto.SyncActionValue.subscriptionAction:type_name -> proto.SubscriptionAction + 164, // 253: proto.SyncActionValue.userStatusMuteAction:type_name -> proto.UserStatusMuteAction + 166, // 254: proto.SyncActionValue.timeFormatAction:type_name -> proto.TimeFormatAction + 181, // 255: proto.SyncActionValue.nuxAction:type_name -> proto.NuxAction + 177, // 256: proto.SyncActionValue.primaryVersionAction:type_name -> proto.PrimaryVersionAction + 170, // 257: proto.SyncActionValue.stickerAction:type_name -> proto.StickerAction + 173, // 258: proto.SyncActionValue.removeRecentStickerAction:type_name -> proto.RemoveRecentStickerAction + 193, // 259: proto.SyncActionValue.chatAssignment:type_name -> proto.ChatAssignmentAction + 192, // 260: proto.SyncActionValue.chatAssignmentOpenedStatus:type_name -> proto.ChatAssignmentOpenedStatusAction + 179, // 261: proto.SyncActionValue.pnForLidChatAction:type_name -> proto.PnForLidChatAction + 151, // 262: proto.SyncActionMessage.key:type_name -> proto.MessageKey + 167, // 263: proto.SyncActionMessageRange.messages:type_name -> proto.SyncActionMessage + 198, // 264: proto.RecentEmojiWeightsAction.weights:type_name -> proto.RecentEmojiWeight + 168, // 265: proto.MarkChatAsReadAction.messageRange:type_name -> proto.SyncActionMessageRange + 168, // 266: proto.DeleteChatAction.messageRange:type_name -> proto.SyncActionMessageRange + 168, // 267: proto.ClearChatAction.messageRange:type_name -> proto.SyncActionMessageRange + 168, // 268: proto.ArchiveChatAction.messageRange:type_name -> proto.SyncActionMessageRange + 163, // 269: proto.SyncActionData.value:type_name -> proto.SyncActionValue + 36, // 270: proto.BizIdentityInfo.vlevel:type_name -> proto.BizIdentityInfo.VerifiedLevelValue + 199, // 271: proto.BizIdentityInfo.vnameCert:type_name -> proto.VerifiedNameCertificate + 37, // 272: proto.BizIdentityInfo.hostStorage:type_name -> proto.BizIdentityInfo.HostStorageType + 38, // 273: proto.BizIdentityInfo.actualActors:type_name -> proto.BizIdentityInfo.ActualActorsType + 199, // 274: proto.BizAccountPayload.vnameCert:type_name -> proto.VerifiedNameCertificate + 39, // 275: proto.BizAccountLinkInfo.hostStorage:type_name -> proto.BizAccountLinkInfo.HostStorageType + 40, // 276: proto.BizAccountLinkInfo.accountType:type_name -> proto.BizAccountLinkInfo.AccountType + 206, // 277: proto.HandshakeMessage.clientHello:type_name -> proto.HandshakeClientHello + 205, // 278: proto.HandshakeMessage.serverHello:type_name -> proto.HandshakeServerHello + 207, // 279: proto.HandshakeMessage.clientFinish:type_name -> proto.HandshakeClientFinish + 273, // 280: proto.ClientPayload.userAgent:type_name -> proto.ClientPayload.UserAgent + 272, // 281: proto.ClientPayload.webInfo:type_name -> proto.ClientPayload.WebInfo + 43, // 282: proto.ClientPayload.connectType:type_name -> proto.ClientPayload.ConnectType + 44, // 283: proto.ClientPayload.connectReason:type_name -> proto.ClientPayload.ConnectReason + 275, // 284: proto.ClientPayload.dnsSource:type_name -> proto.ClientPayload.DNSSource + 274, // 285: proto.ClientPayload.devicePairingData:type_name -> proto.ClientPayload.DevicePairingRegistrationData + 41, // 286: proto.ClientPayload.product:type_name -> proto.ClientPayload.Product + 42, // 287: proto.ClientPayload.iosAppExtension:type_name -> proto.ClientPayload.IOSAppExtension + 210, // 288: proto.WebNotificationsInfo.notifyMessages:type_name -> proto.WebMessageInfo + 151, // 289: proto.WebMessageInfo.key:type_name -> proto.MessageKey + 111, // 290: proto.WebMessageInfo.message:type_name -> proto.Message + 50, // 291: proto.WebMessageInfo.status:type_name -> proto.WebMessageInfo.Status + 49, // 292: proto.WebMessageInfo.messageStubType:type_name -> proto.WebMessageInfo.StubType + 218, // 293: proto.WebMessageInfo.paymentInfo:type_name -> proto.PaymentInfo + 66, // 294: proto.WebMessageInfo.finalLiveLocation:type_name -> proto.LiveLocationMessage + 218, // 295: proto.WebMessageInfo.quotedPaymentInfo:type_name -> proto.PaymentInfo + 51, // 296: proto.WebMessageInfo.bizPrivacyStatus:type_name -> proto.WebMessageInfo.BizPrivacyStatus + 220, // 297: proto.WebMessageInfo.mediaData:type_name -> proto.MediaData + 217, // 298: proto.WebMessageInfo.photoChange:type_name -> proto.PhotoChange + 212, // 299: proto.WebMessageInfo.userReceipt:type_name -> proto.UserReceipt + 214, // 300: proto.WebMessageInfo.reactions:type_name -> proto.Reaction + 220, // 301: proto.WebMessageInfo.quotedStickerData:type_name -> proto.MediaData + 213, // 302: proto.WebMessageInfo.statusPsa:type_name -> proto.StatusPSA + 215, // 303: proto.WebMessageInfo.pollUpdates:type_name -> proto.PollUpdate + 216, // 304: proto.WebMessageInfo.pollAdditionalMetadata:type_name -> proto.PollAdditionalMetadata + 221, // 305: proto.WebMessageInfo.keepInChat:type_name -> proto.KeepInChat + 52, // 306: proto.WebFeatures.labelsDisplay:type_name -> proto.WebFeatures.Flag + 52, // 307: proto.WebFeatures.voipIndividualOutgoing:type_name -> proto.WebFeatures.Flag + 52, // 308: proto.WebFeatures.groupsV3:type_name -> proto.WebFeatures.Flag + 52, // 309: proto.WebFeatures.groupsV3Create:type_name -> proto.WebFeatures.Flag + 52, // 310: proto.WebFeatures.changeNumberV2:type_name -> proto.WebFeatures.Flag + 52, // 311: proto.WebFeatures.queryStatusV3Thumbnail:type_name -> proto.WebFeatures.Flag + 52, // 312: proto.WebFeatures.liveLocations:type_name -> proto.WebFeatures.Flag + 52, // 313: proto.WebFeatures.queryVname:type_name -> proto.WebFeatures.Flag + 52, // 314: proto.WebFeatures.voipIndividualIncoming:type_name -> proto.WebFeatures.Flag + 52, // 315: proto.WebFeatures.quickRepliesQuery:type_name -> proto.WebFeatures.Flag + 52, // 316: proto.WebFeatures.payments:type_name -> proto.WebFeatures.Flag + 52, // 317: proto.WebFeatures.stickerPackQuery:type_name -> proto.WebFeatures.Flag + 52, // 318: proto.WebFeatures.liveLocationsFinal:type_name -> proto.WebFeatures.Flag + 52, // 319: proto.WebFeatures.labelsEdit:type_name -> proto.WebFeatures.Flag + 52, // 320: proto.WebFeatures.mediaUpload:type_name -> proto.WebFeatures.Flag + 52, // 321: proto.WebFeatures.mediaUploadRichQuickReplies:type_name -> proto.WebFeatures.Flag + 52, // 322: proto.WebFeatures.vnameV2:type_name -> proto.WebFeatures.Flag + 52, // 323: proto.WebFeatures.videoPlaybackUrl:type_name -> proto.WebFeatures.Flag + 52, // 324: proto.WebFeatures.statusRanking:type_name -> proto.WebFeatures.Flag + 52, // 325: proto.WebFeatures.voipIndividualVideo:type_name -> proto.WebFeatures.Flag + 52, // 326: proto.WebFeatures.thirdPartyStickers:type_name -> proto.WebFeatures.Flag + 52, // 327: proto.WebFeatures.frequentlyForwardedSetting:type_name -> proto.WebFeatures.Flag + 52, // 328: proto.WebFeatures.groupsV4JoinPermission:type_name -> proto.WebFeatures.Flag + 52, // 329: proto.WebFeatures.recentStickers:type_name -> proto.WebFeatures.Flag + 52, // 330: proto.WebFeatures.catalog:type_name -> proto.WebFeatures.Flag + 52, // 331: proto.WebFeatures.starredStickers:type_name -> proto.WebFeatures.Flag + 52, // 332: proto.WebFeatures.voipGroupCall:type_name -> proto.WebFeatures.Flag + 52, // 333: proto.WebFeatures.templateMessage:type_name -> proto.WebFeatures.Flag + 52, // 334: proto.WebFeatures.templateMessageInteractivity:type_name -> proto.WebFeatures.Flag + 52, // 335: proto.WebFeatures.ephemeralMessages:type_name -> proto.WebFeatures.Flag + 52, // 336: proto.WebFeatures.e2ENotificationSync:type_name -> proto.WebFeatures.Flag + 52, // 337: proto.WebFeatures.recentStickersV2:type_name -> proto.WebFeatures.Flag + 52, // 338: proto.WebFeatures.recentStickersV3:type_name -> proto.WebFeatures.Flag + 52, // 339: proto.WebFeatures.userNotice:type_name -> proto.WebFeatures.Flag + 52, // 340: proto.WebFeatures.support:type_name -> proto.WebFeatures.Flag + 52, // 341: proto.WebFeatures.groupUiiCleanup:type_name -> proto.WebFeatures.Flag + 52, // 342: proto.WebFeatures.groupDogfoodingInternalOnly:type_name -> proto.WebFeatures.Flag + 52, // 343: proto.WebFeatures.settingsSync:type_name -> proto.WebFeatures.Flag + 52, // 344: proto.WebFeatures.archiveV2:type_name -> proto.WebFeatures.Flag + 52, // 345: proto.WebFeatures.ephemeralAllowGroupMembers:type_name -> proto.WebFeatures.Flag + 52, // 346: proto.WebFeatures.ephemeral24HDuration:type_name -> proto.WebFeatures.Flag + 52, // 347: proto.WebFeatures.mdForceUpgrade:type_name -> proto.WebFeatures.Flag + 52, // 348: proto.WebFeatures.disappearingMode:type_name -> proto.WebFeatures.Flag + 52, // 349: proto.WebFeatures.externalMdOptInAvailable:type_name -> proto.WebFeatures.Flag + 52, // 350: proto.WebFeatures.noDeleteMessageTimeLimit:type_name -> proto.WebFeatures.Flag + 151, // 351: proto.Reaction.key:type_name -> proto.MessageKey + 151, // 352: proto.PollUpdate.pollUpdateMessageKey:type_name -> proto.MessageKey + 127, // 353: proto.PollUpdate.vote:type_name -> proto.PollVoteMessage + 55, // 354: proto.PaymentInfo.currencyDeprecated:type_name -> proto.PaymentInfo.Currency + 54, // 355: proto.PaymentInfo.status:type_name -> proto.PaymentInfo.Status + 151, // 356: proto.PaymentInfo.requestMessageKey:type_name -> proto.MessageKey + 53, // 357: proto.PaymentInfo.txnStatus:type_name -> proto.PaymentInfo.TxnStatus + 110, // 358: proto.PaymentInfo.primaryAmount:type_name -> proto.Money + 110, // 359: proto.PaymentInfo.exchangeAmount:type_name -> proto.Money + 151, // 360: proto.NotificationMessageInfo.key:type_name -> proto.MessageKey + 111, // 361: proto.NotificationMessageInfo.message:type_name -> proto.Message + 0, // 362: proto.KeepInChat.keepType:type_name -> proto.KeepType + 151, // 363: proto.KeepInChat.key:type_name -> proto.MessageKey + 279, // 364: proto.CertChain.leaf:type_name -> proto.CertChain.NoiseCertificate + 279, // 365: proto.CertChain.intermediate:type_name -> proto.CertChain.NoiseCertificate + 231, // 366: proto.ListMessage.Section.rows:type_name -> proto.ListMessage.Row + 232, // 367: proto.ListMessage.ProductSection.products:type_name -> proto.ListMessage.Product + 233, // 368: proto.ListMessage.ProductListInfo.productSections:type_name -> proto.ListMessage.ProductSection + 235, // 369: proto.ListMessage.ProductListInfo.headerImage:type_name -> proto.ListMessage.ProductListHeaderImage + 10, // 370: proto.InteractiveMessage.ShopMessage.surface:type_name -> proto.InteractiveMessage.ShopMessage.Surface + 244, // 371: proto.InteractiveMessage.NativeFlowMessage.buttons:type_name -> proto.InteractiveMessage.NativeFlowMessage.NativeFlowButton + 81, // 372: proto.InteractiveMessage.Header.documentMessage:type_name -> proto.DocumentMessage + 74, // 373: proto.InteractiveMessage.Header.imageMessage:type_name -> proto.ImageMessage + 113, // 374: proto.InteractiveMessage.Header.videoMessage:type_name -> proto.VideoMessage + 247, // 375: proto.HighlyStructuredMessage.HSMLocalizableParameter.currency:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMCurrency + 246, // 376: proto.HighlyStructuredMessage.HSMLocalizableParameter.dateTime:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime + 249, // 377: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.component:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent + 248, // 378: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.unixEpoch:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeUnixEpoch + 12, // 379: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.dayOfWeek:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.DayOfWeekType + 13, // 380: proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.calendar:type_name -> proto.HighlyStructuredMessage.HSMLocalizableParameter.HSMDateTime.HSMDateTimeComponent.CalendarType + 252, // 381: proto.ButtonsMessage.Button.buttonText:type_name -> proto.ButtonsMessage.Button.ButtonText + 20, // 382: proto.ButtonsMessage.Button.type:type_name -> proto.ButtonsMessage.Button.Type + 251, // 383: proto.ButtonsMessage.Button.nativeFlowInfo:type_name -> proto.ButtonsMessage.Button.NativeFlowInfo + 22, // 384: proto.ContextInfo.ExternalAdReplyInfo.mediaType:type_name -> proto.ContextInfo.ExternalAdReplyInfo.MediaType + 23, // 385: proto.ContextInfo.AdReplyInfo.mediaType:type_name -> proto.ContextInfo.AdReplyInfo.MediaType + 76, // 386: proto.TemplateButton.URLButton.displayText:type_name -> proto.HighlyStructuredMessage + 76, // 387: proto.TemplateButton.URLButton.url:type_name -> proto.HighlyStructuredMessage + 76, // 388: proto.TemplateButton.QuickReplyButton.displayText:type_name -> proto.HighlyStructuredMessage + 76, // 389: proto.TemplateButton.CallButton.displayText:type_name -> proto.HighlyStructuredMessage + 76, // 390: proto.TemplateButton.CallButton.phoneNumber:type_name -> proto.HighlyStructuredMessage + 101, // 391: proto.TemplateMessage.HydratedFourRowTemplate.hydratedButtons:type_name -> proto.HydratedTemplateButton + 81, // 392: proto.TemplateMessage.HydratedFourRowTemplate.documentMessage:type_name -> proto.DocumentMessage + 74, // 393: proto.TemplateMessage.HydratedFourRowTemplate.imageMessage:type_name -> proto.ImageMessage + 113, // 394: proto.TemplateMessage.HydratedFourRowTemplate.videoMessage:type_name -> proto.VideoMessage + 65, // 395: proto.TemplateMessage.HydratedFourRowTemplate.locationMessage:type_name -> proto.LocationMessage + 76, // 396: proto.TemplateMessage.FourRowTemplate.content:type_name -> proto.HighlyStructuredMessage + 76, // 397: proto.TemplateMessage.FourRowTemplate.footer:type_name -> proto.HighlyStructuredMessage + 107, // 398: proto.TemplateMessage.FourRowTemplate.buttons:type_name -> proto.TemplateButton + 81, // 399: proto.TemplateMessage.FourRowTemplate.documentMessage:type_name -> proto.DocumentMessage + 76, // 400: proto.TemplateMessage.FourRowTemplate.highlyStructuredMessage:type_name -> proto.HighlyStructuredMessage + 74, // 401: proto.TemplateMessage.FourRowTemplate.imageMessage:type_name -> proto.ImageMessage + 113, // 402: proto.TemplateMessage.FourRowTemplate.videoMessage:type_name -> proto.VideoMessage + 65, // 403: proto.TemplateMessage.FourRowTemplate.locationMessage:type_name -> proto.LocationMessage + 74, // 404: proto.ProductMessage.ProductSnapshot.productImage:type_name -> proto.ImageMessage + 74, // 405: proto.ProductMessage.CatalogSnapshot.catalogImage:type_name -> proto.ImageMessage + 34, // 406: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.mediaUploadResult:type_name -> proto.MediaRetryNotification.ResultType + 117, // 407: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.stickerMessage:type_name -> proto.StickerMessage + 269, // 408: proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.linkPreviewResponse:type_name -> proto.PeerDataOperationRequestResponseMessage.PeerDataOperationResult.LinkPreviewResponse + 200, // 409: proto.VerifiedNameCertificate.Details.localizedNames:type_name -> proto.LocalizedName + 276, // 410: proto.ClientPayload.WebInfo.webdPayload:type_name -> proto.ClientPayload.WebInfo.WebdPayload + 45, // 411: proto.ClientPayload.WebInfo.webSubPlatform:type_name -> proto.ClientPayload.WebInfo.WebSubPlatform + 47, // 412: proto.ClientPayload.UserAgent.platform:type_name -> proto.ClientPayload.UserAgent.Platform + 277, // 413: proto.ClientPayload.UserAgent.appVersion:type_name -> proto.ClientPayload.UserAgent.AppVersion + 46, // 414: proto.ClientPayload.UserAgent.releaseChannel:type_name -> proto.ClientPayload.UserAgent.ReleaseChannel + 48, // 415: proto.ClientPayload.DNSSource.dnsMethod:type_name -> proto.ClientPayload.DNSSource.DNSResolutionMethod + 416, // [416:416] is the sub-list for method output_type + 416, // [416:416] is the sub-list for method input_type + 416, // [416:416] is the sub-list for extension type_name + 416, // [416:416] is the sub-list for extension extendee + 0, // [0:416] is the sub-list for field type_name } func init() { file_binary_proto_def_proto_init() } @@ -22964,18 +23589,6 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[6].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PeerDataOperationRequestResponseMessage); i { - case 0: - return &v.state - case 1: - return &v.sizeCache - case 2: - return &v.unknownFields - default: - return nil - } - } - file_binary_proto_def_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*PeerDataOperationRequestMessage); i { case 0: return &v.state @@ -22987,7 +23600,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[7].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*PaymentInviteMessage); i { case 0: return &v.state @@ -22999,7 +23612,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[8].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*OrderMessage); i { case 0: return &v.state @@ -23011,7 +23624,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[9].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*LocationMessage); i { case 0: return &v.state @@ -23023,7 +23636,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[10].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*LiveLocationMessage); i { case 0: return &v.state @@ -23035,7 +23648,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[11].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ListResponseMessage); i { case 0: return &v.state @@ -23047,7 +23660,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[12].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ListMessage); i { case 0: return &v.state @@ -23059,7 +23672,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[13].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*KeepInChatMessage); i { case 0: return &v.state @@ -23071,7 +23684,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[14].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*InvoiceMessage); i { case 0: return &v.state @@ -23083,7 +23696,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[15].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*InteractiveResponseMessage); i { case 0: return &v.state @@ -23095,7 +23708,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[17].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[16].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*InteractiveMessage); i { case 0: return &v.state @@ -23107,7 +23720,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[18].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[17].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*InitialSecurityNotificationSettingSync); i { case 0: return &v.state @@ -23119,7 +23732,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[19].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[18].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ImageMessage); i { case 0: return &v.state @@ -23131,7 +23744,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[20].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[19].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*HistorySyncNotification); i { case 0: return &v.state @@ -23143,7 +23756,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[21].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[20].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*HighlyStructuredMessage); i { case 0: return &v.state @@ -23155,7 +23768,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[22].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[21].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*GroupInviteMessage); i { case 0: return &v.state @@ -23167,7 +23780,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[23].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[22].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*FutureProofMessage); i { case 0: return &v.state @@ -23179,7 +23792,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[24].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[23].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ExtendedTextMessage); i { case 0: return &v.state @@ -23191,7 +23804,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[25].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[24].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*EncReactionMessage); i { case 0: return &v.state @@ -23203,7 +23816,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[26].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[25].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*DocumentMessage); i { case 0: return &v.state @@ -23215,7 +23828,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[27].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[26].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*DeviceSentMessage); i { case 0: return &v.state @@ -23227,7 +23840,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[27].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*DeclinePaymentRequestMessage); i { case 0: return &v.state @@ -23239,7 +23852,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[29].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[28].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ContactsArrayMessage); i { case 0: return &v.state @@ -23251,7 +23864,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[30].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[29].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ContactMessage); i { case 0: return &v.state @@ -23263,7 +23876,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[31].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[30].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Chat); i { case 0: return &v.state @@ -23275,7 +23888,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[32].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[31].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*CancelPaymentRequestMessage); i { case 0: return &v.state @@ -23287,7 +23900,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[33].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[32].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Call); i { case 0: return &v.state @@ -23299,7 +23912,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[34].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[33].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ButtonsResponseMessage); i { case 0: return &v.state @@ -23311,7 +23924,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[35].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[34].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*ButtonsMessage); i { case 0: return &v.state @@ -23323,7 +23936,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[36].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[35].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AudioMessage); i { case 0: return &v.state @@ -23335,7 +23948,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[37].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[36].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateSyncKey); i { case 0: return &v.state @@ -23347,7 +23960,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[38].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[37].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateSyncKeyShare); i { case 0: return &v.state @@ -23359,7 +23972,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[39].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[38].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateSyncKeyRequest); i { case 0: return &v.state @@ -23371,7 +23984,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[40].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[39].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateSyncKeyId); i { case 0: return &v.state @@ -23383,7 +23996,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[41].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[40].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateSyncKeyFingerprint); i { case 0: return &v.state @@ -23395,7 +24008,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[42].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[41].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateSyncKeyData); i { case 0: return &v.state @@ -23407,7 +24020,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[43].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[42].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*AppStateFatalExceptionNotification); i { case 0: return &v.state @@ -23419,7 +24032,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[44].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[43].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*Location); i { case 0: return &v.state @@ -23431,7 +24044,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[45].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[44].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*InteractiveAnnotation); i { case 0: return &v.state @@ -23443,7 +24056,7 @@ func file_binary_proto_def_proto_init() { return nil } } - file_binary_proto_def_proto_msgTypes[46].Exporter = func(v interface{}, i int) interface{} { + file_binary_proto_def_proto_msgTypes[45].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*HydratedTemplateButton); i { case 0: return &v.state @@ -23455,6 +24068,18 @@ func file_binary_proto_def_proto_init() { return nil } } + file_binary_proto_def_proto_msgTypes[46].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*GroupMention); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } file_binary_proto_def_proto_msgTypes[47].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*DisappearingMode); i { case 0: @@ -23660,7 +24285,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[64].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RequestPhoneNumberMessage); i { + switch v := v.(*ScheduledCallEditMessage); i { case 0: return &v.state case 1: @@ -23672,7 +24297,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[65].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RequestPaymentMessage); i { + switch v := v.(*ScheduledCallCreationMessage); i { case 0: return &v.state case 1: @@ -23684,7 +24309,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[66].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ReactionMessage); i { + switch v := v.(*RequestPhoneNumberMessage); i { case 0: return &v.state case 1: @@ -23696,7 +24321,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[67].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ProtocolMessage); i { + switch v := v.(*RequestPaymentMessage); i { case 0: return &v.state case 1: @@ -23708,7 +24333,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[68].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ProductMessage); i { + switch v := v.(*ReactionMessage); i { case 0: return &v.state case 1: @@ -23720,7 +24345,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[69].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollVoteMessage); i { + switch v := v.(*ProtocolMessage); i { case 0: return &v.state case 1: @@ -23732,7 +24357,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[70].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollUpdateMessage); i { + switch v := v.(*ProductMessage); i { case 0: return &v.state case 1: @@ -23744,7 +24369,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[71].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollUpdateMessageMetadata); i { + switch v := v.(*PollVoteMessage); i { case 0: return &v.state case 1: @@ -23756,7 +24381,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[72].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollEncValue); i { + switch v := v.(*PollUpdateMessage); i { case 0: return &v.state case 1: @@ -23768,7 +24393,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[73].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollCreationMessage); i { + switch v := v.(*PollUpdateMessageMetadata); i { case 0: return &v.state case 1: @@ -23780,7 +24405,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[74].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*EphemeralSetting); i { + switch v := v.(*PollEncValue); i { case 0: return &v.state case 1: @@ -23792,7 +24417,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[75].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*WallpaperSettings); i { + switch v := v.(*PollCreationMessage); i { case 0: return &v.state case 1: @@ -23804,7 +24429,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[76].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StickerMetadata); i { + switch v := v.(*PinMessage); i { case 0: return &v.state case 1: @@ -23816,7 +24441,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[77].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Pushname); i { + switch v := v.(*PeerDataOperationRequestResponseMessage); i { case 0: return &v.state case 1: @@ -23828,7 +24453,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[78].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PastParticipants); i { + switch v := v.(*EphemeralSetting); i { case 0: return &v.state case 1: @@ -23840,7 +24465,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[79].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PastParticipant); i { + switch v := v.(*WallpaperSettings); i { case 0: return &v.state case 1: @@ -23852,7 +24477,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[80].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HistorySync); i { + switch v := v.(*StickerMetadata); i { case 0: return &v.state case 1: @@ -23864,7 +24489,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[81].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HistorySyncMsg); i { + switch v := v.(*Pushname); i { case 0: return &v.state case 1: @@ -23876,7 +24501,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[82].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*GroupParticipant); i { + switch v := v.(*PastParticipants); i { case 0: return &v.state case 1: @@ -23888,7 +24513,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[83].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*GlobalSettings); i { + switch v := v.(*PastParticipant); i { case 0: return &v.state case 1: @@ -23900,7 +24525,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[84].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Conversation); i { + switch v := v.(*HistorySync); i { case 0: return &v.state case 1: @@ -23912,7 +24537,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[85].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*AvatarUserSettings); i { + switch v := v.(*HistorySyncMsg); i { case 0: return &v.state case 1: @@ -23924,7 +24549,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[86].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*AutoDownloadSettings); i { + switch v := v.(*GroupParticipant); i { case 0: return &v.state case 1: @@ -23936,7 +24561,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[87].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MsgRowOpaqueData); i { + switch v := v.(*GlobalSettings); i { case 0: return &v.state case 1: @@ -23948,7 +24573,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[88].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MsgOpaqueData); i { + switch v := v.(*Conversation); i { case 0: return &v.state case 1: @@ -23960,7 +24585,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[89].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ServerErrorReceipt); i { + switch v := v.(*AvatarUserSettings); i { case 0: return &v.state case 1: @@ -23972,7 +24597,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[90].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MediaRetryNotification); i { + switch v := v.(*AutoDownloadSettings); i { case 0: return &v.state case 1: @@ -23984,7 +24609,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[91].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MessageKey); i { + switch v := v.(*MsgRowOpaqueData); i { case 0: return &v.state case 1: @@ -23996,7 +24621,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[92].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdVersion); i { + switch v := v.(*MsgOpaqueData); i { case 0: return &v.state case 1: @@ -24008,7 +24633,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[93].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdValue); i { + switch v := v.(*ServerErrorReceipt); i { case 0: return &v.state case 1: @@ -24020,7 +24645,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[94].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdSnapshot); i { + switch v := v.(*MediaRetryNotification); i { case 0: return &v.state case 1: @@ -24032,7 +24657,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[95].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdRecord); i { + switch v := v.(*MessageKey); i { case 0: return &v.state case 1: @@ -24044,7 +24669,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[96].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdPatch); i { + switch v := v.(*SyncdVersion); i { case 0: return &v.state case 1: @@ -24056,7 +24681,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[97].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdMutations); i { + switch v := v.(*SyncdValue); i { case 0: return &v.state case 1: @@ -24068,7 +24693,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[98].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdMutation); i { + switch v := v.(*SyncdSnapshot); i { case 0: return &v.state case 1: @@ -24080,7 +24705,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[99].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncdIndex); i { + switch v := v.(*SyncdRecord); i { case 0: return &v.state case 1: @@ -24092,7 +24717,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[100].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*KeyId); i { + switch v := v.(*SyncdPatch); i { case 0: return &v.state case 1: @@ -24104,7 +24729,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[101].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ExternalBlobReference); i { + switch v := v.(*SyncdMutations); i { case 0: return &v.state case 1: @@ -24116,7 +24741,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[102].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ExitCode); i { + switch v := v.(*SyncdMutation); i { case 0: return &v.state case 1: @@ -24128,7 +24753,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[103].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncActionValue); i { + switch v := v.(*SyncdIndex); i { case 0: return &v.state case 1: @@ -24140,7 +24765,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[104].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*UserStatusMuteAction); i { + switch v := v.(*KeyId); i { case 0: return &v.state case 1: @@ -24152,7 +24777,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[105].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*UnarchiveChatsSetting); i { + switch v := v.(*ExternalBlobReference); i { case 0: return &v.state case 1: @@ -24164,7 +24789,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[106].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TimeFormatAction); i { + switch v := v.(*ExitCode); i { case 0: return &v.state case 1: @@ -24176,7 +24801,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[107].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncActionMessage); i { + switch v := v.(*SyncActionValue); i { case 0: return &v.state case 1: @@ -24188,7 +24813,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[108].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncActionMessageRange); i { + switch v := v.(*UserStatusMuteAction); i { case 0: return &v.state case 1: @@ -24200,7 +24825,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[109].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SubscriptionAction); i { + switch v := v.(*UnarchiveChatsSetting); i { case 0: return &v.state case 1: @@ -24212,7 +24837,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[110].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StickerAction); i { + switch v := v.(*TimeFormatAction); i { case 0: return &v.state case 1: @@ -24224,7 +24849,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[111].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StarAction); i { + switch v := v.(*SyncActionMessage); i { case 0: return &v.state case 1: @@ -24236,7 +24861,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[112].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SecurityNotificationSetting); i { + switch v := v.(*SyncActionMessageRange); i { case 0: return &v.state case 1: @@ -24248,7 +24873,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[113].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RemoveRecentStickerAction); i { + switch v := v.(*SubscriptionAction); i { case 0: return &v.state case 1: @@ -24260,7 +24885,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[114].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RecentEmojiWeightsAction); i { + switch v := v.(*StickerAction); i { case 0: return &v.state case 1: @@ -24272,7 +24897,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[115].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*QuickReplyAction); i { + switch v := v.(*StarAction); i { case 0: return &v.state case 1: @@ -24284,7 +24909,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[116].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PushNameSetting); i { + switch v := v.(*SecurityNotificationSetting); i { case 0: return &v.state case 1: @@ -24296,7 +24921,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[117].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PrimaryVersionAction); i { + switch v := v.(*RemoveRecentStickerAction); i { case 0: return &v.state case 1: @@ -24308,7 +24933,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[118].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PrimaryFeature); i { + switch v := v.(*RecentEmojiWeightsAction); i { case 0: return &v.state case 1: @@ -24320,7 +24945,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[119].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PnForLidChatAction); i { + switch v := v.(*QuickReplyAction); i { case 0: return &v.state case 1: @@ -24332,7 +24957,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[120].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PinAction); i { + switch v := v.(*PushNameSetting); i { case 0: return &v.state case 1: @@ -24344,7 +24969,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[121].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*NuxAction); i { + switch v := v.(*PrimaryVersionAction); i { case 0: return &v.state case 1: @@ -24356,7 +24981,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[122].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MuteAction); i { + switch v := v.(*PrimaryFeature); i { case 0: return &v.state case 1: @@ -24368,7 +24993,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[123].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MarkChatAsReadAction); i { + switch v := v.(*PnForLidChatAction); i { case 0: return &v.state case 1: @@ -24380,7 +25005,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[124].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*LocaleSetting); i { + switch v := v.(*PinAction); i { case 0: return &v.state case 1: @@ -24392,7 +25017,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[125].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*LabelEditAction); i { + switch v := v.(*NuxAction); i { case 0: return &v.state case 1: @@ -24404,7 +25029,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[126].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*LabelAssociationAction); i { + switch v := v.(*MuteAction); i { case 0: return &v.state case 1: @@ -24416,7 +25041,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[127].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*KeyExpiration); i { + switch v := v.(*MarkChatAsReadAction); i { case 0: return &v.state case 1: @@ -24428,7 +25053,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[128].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DeleteMessageForMeAction); i { + switch v := v.(*LocaleSetting); i { case 0: return &v.state case 1: @@ -24440,7 +25065,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[129].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DeleteChatAction); i { + switch v := v.(*LabelEditAction); i { case 0: return &v.state case 1: @@ -24452,7 +25077,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[130].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ContactAction); i { + switch v := v.(*LabelAssociationAction); i { case 0: return &v.state case 1: @@ -24464,7 +25089,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[131].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClearChatAction); i { + switch v := v.(*KeyExpiration); i { case 0: return &v.state case 1: @@ -24476,7 +25101,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[132].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ChatAssignmentOpenedStatusAction); i { + switch v := v.(*DeleteMessageForMeAction); i { case 0: return &v.state case 1: @@ -24488,7 +25113,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[133].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ChatAssignmentAction); i { + switch v := v.(*DeleteChatAction); i { case 0: return &v.state case 1: @@ -24500,7 +25125,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[134].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ArchiveChatAction); i { + switch v := v.(*ContactAction); i { case 0: return &v.state case 1: @@ -24512,7 +25137,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[135].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*AndroidUnsupportedActions); i { + switch v := v.(*ClearChatAction); i { case 0: return &v.state case 1: @@ -24524,7 +25149,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[136].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*AgentAction); i { + switch v := v.(*ChatAssignmentOpenedStatusAction); i { case 0: return &v.state case 1: @@ -24536,7 +25161,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[137].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*SyncActionData); i { + switch v := v.(*ChatAssignmentAction); i { case 0: return &v.state case 1: @@ -24548,7 +25173,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[138].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*RecentEmojiWeight); i { + switch v := v.(*ArchiveChatAction); i { case 0: return &v.state case 1: @@ -24560,7 +25185,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[139].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*VerifiedNameCertificate); i { + switch v := v.(*AndroidUnsupportedActions); i { case 0: return &v.state case 1: @@ -24572,7 +25197,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[140].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*LocalizedName); i { + switch v := v.(*AgentAction); i { case 0: return &v.state case 1: @@ -24584,7 +25209,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[141].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*BizIdentityInfo); i { + switch v := v.(*SyncActionData); i { case 0: return &v.state case 1: @@ -24596,7 +25221,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[142].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*BizAccountPayload); i { + switch v := v.(*RecentEmojiWeight); i { case 0: return &v.state case 1: @@ -24608,7 +25233,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[143].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*BizAccountLinkInfo); i { + switch v := v.(*VerifiedNameCertificate); i { case 0: return &v.state case 1: @@ -24620,7 +25245,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[144].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HandshakeMessage); i { + switch v := v.(*LocalizedName); i { case 0: return &v.state case 1: @@ -24632,7 +25257,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[145].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HandshakeServerHello); i { + switch v := v.(*BizIdentityInfo); i { case 0: return &v.state case 1: @@ -24644,7 +25269,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[146].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HandshakeClientHello); i { + switch v := v.(*BizAccountPayload); i { case 0: return &v.state case 1: @@ -24656,7 +25281,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[147].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HandshakeClientFinish); i { + switch v := v.(*BizAccountLinkInfo); i { case 0: return &v.state case 1: @@ -24668,7 +25293,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[148].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload); i { + switch v := v.(*HandshakeMessage); i { case 0: return &v.state case 1: @@ -24680,7 +25305,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[149].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*WebNotificationsInfo); i { + switch v := v.(*HandshakeServerHello); i { case 0: return &v.state case 1: @@ -24692,7 +25317,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[150].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*WebMessageInfo); i { + switch v := v.(*HandshakeClientHello); i { case 0: return &v.state case 1: @@ -24704,7 +25329,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[151].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*WebFeatures); i { + switch v := v.(*HandshakeClientFinish); i { case 0: return &v.state case 1: @@ -24716,7 +25341,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[152].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*UserReceipt); i { + switch v := v.(*ClientPayload); i { case 0: return &v.state case 1: @@ -24728,7 +25353,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[153].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*StatusPSA); i { + switch v := v.(*WebNotificationsInfo); i { case 0: return &v.state case 1: @@ -24740,7 +25365,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[154].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*Reaction); i { + switch v := v.(*WebMessageInfo); i { case 0: return &v.state case 1: @@ -24752,7 +25377,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[155].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollUpdate); i { + switch v := v.(*WebFeatures); i { case 0: return &v.state case 1: @@ -24764,7 +25389,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[156].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollAdditionalMetadata); i { + switch v := v.(*UserReceipt); i { case 0: return &v.state case 1: @@ -24776,7 +25401,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[157].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PhotoChange); i { + switch v := v.(*StatusPSA); i { case 0: return &v.state case 1: @@ -24788,7 +25413,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[158].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PaymentInfo); i { + switch v := v.(*Reaction); i { case 0: return &v.state case 1: @@ -24800,7 +25425,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[159].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*NotificationMessageInfo); i { + switch v := v.(*PollUpdate); i { case 0: return &v.state case 1: @@ -24812,7 +25437,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[160].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MediaData); i { + switch v := v.(*PollAdditionalMetadata); i { case 0: return &v.state case 1: @@ -24824,7 +25449,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[161].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*KeepInChat); i { + switch v := v.(*PhotoChange); i { case 0: return &v.state case 1: @@ -24836,7 +25461,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[162].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*NoiseCertificate); i { + switch v := v.(*PaymentInfo); i { case 0: return &v.state case 1: @@ -24848,7 +25473,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[163].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*CertChain); i { + switch v := v.(*NotificationMessageInfo); i { case 0: return &v.state case 1: @@ -24860,7 +25485,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[164].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DeviceProps_HistorySyncConfig); i { + switch v := v.(*MediaData); i { case 0: return &v.state case 1: @@ -24872,7 +25497,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[165].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*DeviceProps_AppVersion); i { + switch v := v.(*KeepInChat); i { case 0: return &v.state case 1: @@ -24884,7 +25509,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[166].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PeerDataOperationRequestResponseMessage_PeerDataOperationResult); i { + switch v := v.(*NoiseCertificate); i { case 0: return &v.state case 1: @@ -24896,7 +25521,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[167].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse); i { + switch v := v.(*CertChain); i { case 0: return &v.state case 1: @@ -24908,7 +25533,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[168].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PeerDataOperationRequestMessage_RequestUrlPreview); i { + switch v := v.(*DeviceProps_HistorySyncConfig); i { case 0: return &v.state case 1: @@ -24920,7 +25545,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[169].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PeerDataOperationRequestMessage_RequestStickerReupload); i { + switch v := v.(*DeviceProps_AppVersion); i { case 0: return &v.state case 1: @@ -24932,7 +25557,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[170].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListResponseMessage_SingleSelectReply); i { + switch v := v.(*PeerDataOperationRequestMessage_RequestUrlPreview); i { case 0: return &v.state case 1: @@ -24944,7 +25569,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[171].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListMessage_Section); i { + switch v := v.(*PeerDataOperationRequestMessage_RequestStickerReupload); i { case 0: return &v.state case 1: @@ -24956,7 +25581,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[172].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListMessage_Row); i { + switch v := v.(*PeerDataOperationRequestMessage_HistorySyncOnDemandRequest); i { case 0: return &v.state case 1: @@ -24968,7 +25593,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[173].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListMessage_Product); i { + switch v := v.(*ListResponseMessage_SingleSelectReply); i { case 0: return &v.state case 1: @@ -24980,7 +25605,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[174].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListMessage_ProductSection); i { + switch v := v.(*ListMessage_Section); i { case 0: return &v.state case 1: @@ -24992,7 +25617,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[175].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListMessage_ProductListInfo); i { + switch v := v.(*ListMessage_Row); i { case 0: return &v.state case 1: @@ -25004,7 +25629,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[176].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ListMessage_ProductListHeaderImage); i { + switch v := v.(*ListMessage_Product); i { case 0: return &v.state case 1: @@ -25016,7 +25641,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[177].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveResponseMessage_NativeFlowResponseMessage); i { + switch v := v.(*ListMessage_ProductSection); i { case 0: return &v.state case 1: @@ -25028,7 +25653,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[178].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveResponseMessage_Body); i { + switch v := v.(*ListMessage_ProductListInfo); i { case 0: return &v.state case 1: @@ -25040,7 +25665,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[179].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_ShopMessage); i { + switch v := v.(*ListMessage_ProductListHeaderImage); i { case 0: return &v.state case 1: @@ -25052,7 +25677,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[180].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_NativeFlowMessage); i { + switch v := v.(*InteractiveResponseMessage_NativeFlowResponseMessage); i { case 0: return &v.state case 1: @@ -25064,7 +25689,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[181].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_Header); i { + switch v := v.(*InteractiveResponseMessage_Body); i { case 0: return &v.state case 1: @@ -25076,7 +25701,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[182].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_Footer); i { + switch v := v.(*InteractiveMessage_ShopMessage); i { case 0: return &v.state case 1: @@ -25088,7 +25713,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[183].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_CollectionMessage); i { + switch v := v.(*InteractiveMessage_NativeFlowMessage); i { case 0: return &v.state case 1: @@ -25100,7 +25725,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[184].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_Body); i { + switch v := v.(*InteractiveMessage_Header); i { case 0: return &v.state case 1: @@ -25112,7 +25737,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[185].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*InteractiveMessage_NativeFlowMessage_NativeFlowButton); i { + switch v := v.(*InteractiveMessage_Footer); i { case 0: return &v.state case 1: @@ -25124,7 +25749,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[186].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter); i { + switch v := v.(*InteractiveMessage_CollectionMessage); i { case 0: return &v.state case 1: @@ -25136,7 +25761,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[187].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime); i { + switch v := v.(*InteractiveMessage_Body); i { case 0: return &v.state case 1: @@ -25148,7 +25773,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[188].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency); i { + switch v := v.(*InteractiveMessage_NativeFlowMessage_NativeFlowButton); i { case 0: return &v.state case 1: @@ -25160,7 +25785,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[189].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch); i { + switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter); i { case 0: return &v.state case 1: @@ -25172,7 +25797,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[190].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent); i { + switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime); i { case 0: return &v.state case 1: @@ -25184,7 +25809,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[191].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ButtonsMessage_Button); i { + switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMCurrency); i { case 0: return &v.state case 1: @@ -25196,7 +25821,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[192].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ButtonsMessage_Button_NativeFlowInfo); i { + switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeUnixEpoch); i { case 0: return &v.state case 1: @@ -25208,7 +25833,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[193].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ButtonsMessage_Button_ButtonText); i { + switch v := v.(*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_HSMDateTimeComponent); i { case 0: return &v.state case 1: @@ -25220,7 +25845,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[194].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HydratedTemplateButton_HydratedURLButton); i { + switch v := v.(*ButtonsMessage_Button); i { case 0: return &v.state case 1: @@ -25232,7 +25857,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[195].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HydratedTemplateButton_HydratedQuickReplyButton); i { + switch v := v.(*ButtonsMessage_Button_NativeFlowInfo); i { case 0: return &v.state case 1: @@ -25244,7 +25869,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[196].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*HydratedTemplateButton_HydratedCallButton); i { + switch v := v.(*ButtonsMessage_Button_ButtonText); i { case 0: return &v.state case 1: @@ -25256,7 +25881,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[197].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ContextInfo_ExternalAdReplyInfo); i { + switch v := v.(*HydratedTemplateButton_HydratedURLButton); i { case 0: return &v.state case 1: @@ -25268,7 +25893,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[198].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ContextInfo_AdReplyInfo); i { + switch v := v.(*HydratedTemplateButton_HydratedQuickReplyButton); i { case 0: return &v.state case 1: @@ -25280,7 +25905,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[199].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TemplateButton_URLButton); i { + switch v := v.(*HydratedTemplateButton_HydratedCallButton); i { case 0: return &v.state case 1: @@ -25292,7 +25917,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[200].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TemplateButton_QuickReplyButton); i { + switch v := v.(*ContextInfo_UTMInfo); i { case 0: return &v.state case 1: @@ -25304,7 +25929,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[201].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TemplateButton_CallButton); i { + switch v := v.(*ContextInfo_ExternalAdReplyInfo); i { case 0: return &v.state case 1: @@ -25316,7 +25941,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[202].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PaymentBackground_MediaData); i { + switch v := v.(*ContextInfo_AdReplyInfo); i { case 0: return &v.state case 1: @@ -25328,7 +25953,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[203].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TemplateMessage_HydratedFourRowTemplate); i { + switch v := v.(*TemplateButton_URLButton); i { case 0: return &v.state case 1: @@ -25340,7 +25965,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[204].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*TemplateMessage_FourRowTemplate); i { + switch v := v.(*TemplateButton_QuickReplyButton); i { case 0: return &v.state case 1: @@ -25352,7 +25977,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[205].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ProductMessage_ProductSnapshot); i { + switch v := v.(*TemplateButton_CallButton); i { case 0: return &v.state case 1: @@ -25364,7 +25989,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[206].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ProductMessage_CatalogSnapshot); i { + switch v := v.(*PaymentBackground_MediaData); i { case 0: return &v.state case 1: @@ -25376,7 +26001,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[207].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*PollCreationMessage_Option); i { + switch v := v.(*TemplateMessage_HydratedFourRowTemplate); i { case 0: return &v.state case 1: @@ -25388,7 +26013,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[208].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*MsgOpaqueData_PollOption); i { + switch v := v.(*TemplateMessage_FourRowTemplate); i { case 0: return &v.state case 1: @@ -25400,7 +26025,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[209].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*VerifiedNameCertificate_Details); i { + switch v := v.(*ProductMessage_ProductSnapshot); i { case 0: return &v.state case 1: @@ -25412,7 +26037,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[210].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload_WebInfo); i { + switch v := v.(*ProductMessage_CatalogSnapshot); i { case 0: return &v.state case 1: @@ -25424,7 +26049,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[211].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload_UserAgent); i { + switch v := v.(*PollCreationMessage_Option); i { case 0: return &v.state case 1: @@ -25436,7 +26061,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[212].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload_DevicePairingRegistrationData); i { + switch v := v.(*PeerDataOperationRequestResponseMessage_PeerDataOperationResult); i { case 0: return &v.state case 1: @@ -25448,7 +26073,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[213].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload_DNSSource); i { + switch v := v.(*PeerDataOperationRequestResponseMessage_PeerDataOperationResult_LinkPreviewResponse); i { case 0: return &v.state case 1: @@ -25460,7 +26085,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[214].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload_WebInfo_WebdPayload); i { + switch v := v.(*MsgOpaqueData_PollOption); i { case 0: return &v.state case 1: @@ -25472,7 +26097,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[215].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*ClientPayload_UserAgent_AppVersion); i { + switch v := v.(*VerifiedNameCertificate_Details); i { case 0: return &v.state case 1: @@ -25484,7 +26109,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[216].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*NoiseCertificate_Details); i { + switch v := v.(*ClientPayload_WebInfo); i { case 0: return &v.state case 1: @@ -25496,7 +26121,7 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[217].Exporter = func(v interface{}, i int) interface{} { - switch v := v.(*CertChain_NoiseCertificate); i { + switch v := v.(*ClientPayload_UserAgent); i { case 0: return &v.state case 1: @@ -25508,6 +26133,78 @@ func file_binary_proto_def_proto_init() { } } file_binary_proto_def_proto_msgTypes[218].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*ClientPayload_DevicePairingRegistrationData); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_binary_proto_def_proto_msgTypes[219].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*ClientPayload_DNSSource); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_binary_proto_def_proto_msgTypes[220].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*ClientPayload_WebInfo_WebdPayload); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_binary_proto_def_proto_msgTypes[221].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*ClientPayload_UserAgent_AppVersion); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_binary_proto_def_proto_msgTypes[222].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*NoiseCertificate_Details); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_binary_proto_def_proto_msgTypes[223].Exporter = func(v interface{}, i int) interface{} { + switch v := v.(*CertChain_NoiseCertificate); i { + case 0: + return &v.state + case 1: + return &v.sizeCache + case 2: + return &v.unknownFields + default: + return nil + } + } + file_binary_proto_def_proto_msgTypes[224].Exporter = func(v interface{}, i int) interface{} { switch v := v.(*CertChain_NoiseCertificate_Details); i { case 0: return &v.state @@ -25520,28 +26217,28 @@ func file_binary_proto_def_proto_init() { } } } - file_binary_proto_def_proto_msgTypes[16].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[15].OneofWrappers = []interface{}{ (*InteractiveResponseMessage_NativeFlowResponseMessage_)(nil), } - file_binary_proto_def_proto_msgTypes[17].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[16].OneofWrappers = []interface{}{ (*InteractiveMessage_ShopStorefrontMessage)(nil), (*InteractiveMessage_CollectionMessage_)(nil), (*InteractiveMessage_NativeFlowMessage_)(nil), } - file_binary_proto_def_proto_msgTypes[34].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[33].OneofWrappers = []interface{}{ (*ButtonsResponseMessage_SelectedDisplayText)(nil), } - file_binary_proto_def_proto_msgTypes[35].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[34].OneofWrappers = []interface{}{ (*ButtonsMessage_Text)(nil), (*ButtonsMessage_DocumentMessage)(nil), (*ButtonsMessage_ImageMessage)(nil), (*ButtonsMessage_VideoMessage)(nil), (*ButtonsMessage_LocationMessage)(nil), } - file_binary_proto_def_proto_msgTypes[45].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[44].OneofWrappers = []interface{}{ (*InteractiveAnnotation_Location)(nil), } - file_binary_proto_def_proto_msgTypes[46].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[45].OneofWrappers = []interface{}{ (*HydratedTemplateButton_QuickReplyButton)(nil), (*HydratedTemplateButton_UrlButton)(nil), (*HydratedTemplateButton_CallButton)(nil), @@ -25556,28 +26253,28 @@ func file_binary_proto_def_proto_init() { (*TemplateMessage_HydratedFourRowTemplate_)(nil), (*TemplateMessage_InteractiveMessageTemplate)(nil), } - file_binary_proto_def_proto_msgTypes[181].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[184].OneofWrappers = []interface{}{ (*InteractiveMessage_Header_DocumentMessage)(nil), (*InteractiveMessage_Header_ImageMessage)(nil), (*InteractiveMessage_Header_JpegThumbnail)(nil), (*InteractiveMessage_Header_VideoMessage)(nil), } - file_binary_proto_def_proto_msgTypes[186].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[189].OneofWrappers = []interface{}{ (*HighlyStructuredMessage_HSMLocalizableParameter_Currency)(nil), (*HighlyStructuredMessage_HSMLocalizableParameter_DateTime)(nil), } - file_binary_proto_def_proto_msgTypes[187].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[190].OneofWrappers = []interface{}{ (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_Component)(nil), (*HighlyStructuredMessage_HSMLocalizableParameter_HSMDateTime_UnixEpoch)(nil), } - file_binary_proto_def_proto_msgTypes[203].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[207].OneofWrappers = []interface{}{ (*TemplateMessage_HydratedFourRowTemplate_DocumentMessage)(nil), (*TemplateMessage_HydratedFourRowTemplate_HydratedTitleText)(nil), (*TemplateMessage_HydratedFourRowTemplate_ImageMessage)(nil), (*TemplateMessage_HydratedFourRowTemplate_VideoMessage)(nil), (*TemplateMessage_HydratedFourRowTemplate_LocationMessage)(nil), } - file_binary_proto_def_proto_msgTypes[204].OneofWrappers = []interface{}{ + file_binary_proto_def_proto_msgTypes[208].OneofWrappers = []interface{}{ (*TemplateMessage_FourRowTemplate_DocumentMessage)(nil), (*TemplateMessage_FourRowTemplate_HighlyStructuredMessage)(nil), (*TemplateMessage_FourRowTemplate_ImageMessage)(nil), @@ -25589,8 +26286,8 @@ func file_binary_proto_def_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: file_binary_proto_def_proto_rawDesc, - NumEnums: 54, - NumMessages: 219, + NumEnums: 56, + NumMessages: 225, NumExtensions: 0, NumServices: 0, }, diff --git a/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.raw b/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.raw index 52c96950..827172ab 100644 Binary files a/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.raw and b/vendor/go.mau.fi/whatsmeow/binary/proto/def.pb.raw differ diff --git a/vendor/go.mau.fi/whatsmeow/binary/proto/def.proto b/vendor/go.mau.fi/whatsmeow/binary/proto/def.proto index b72ab79c..cdfc0c35 100644 --- a/vendor/go.mau.fi/whatsmeow/binary/proto/def.proto +++ b/vendor/go.mau.fi/whatsmeow/binary/proto/def.proto @@ -47,6 +47,10 @@ message DeviceProps { ALOHA = 11; CATALINA = 12; TCL_TV = 13; + IOS_PHONE = 14; + IOS_CATALYST = 15; + ANDROID_PHONE = 16; + ANDROID_AMBIGUOUS = 17; } message HistorySyncConfig { optional uint32 fullSyncDaysLimit = 1; @@ -69,33 +73,6 @@ message DeviceProps { optional HistorySyncConfig historySyncConfig = 5; } -enum PeerDataOperationRequestType { - UPLOAD_STICKER = 0; - SEND_RECENT_STICKER_BOOTSTRAP = 1; - GENERATE_LINK_PREVIEW = 2; -} -message PeerDataOperationRequestResponseMessage { - message PeerDataOperationResult { - message LinkPreviewResponse { - optional string url = 1; - optional string title = 2; - optional string description = 3; - optional bytes thumbData = 4; - optional string canonicalUrl = 5; - optional string matchText = 6; - optional string previewType = 7; - } - - optional MediaRetryNotification.ResultType mediaUploadResult = 1; - optional StickerMessage stickerMessage = 2; - optional LinkPreviewResponse linkPreviewResponse = 3; - } - - optional PeerDataOperationRequestType peerDataOperationRequestType = 1; - optional string stanzaId = 2; - repeated PeerDataOperationResult peerDataOperationResult = 3; -} - message PeerDataOperationRequestMessage { message RequestUrlPreview { optional string url = 1; @@ -105,9 +82,18 @@ message PeerDataOperationRequestMessage { optional string fileSha256 = 1; } + message HistorySyncOnDemandRequest { + optional string chatJid = 1; + optional string oldestMsgId = 2; + optional bool oldestMsgFromMe = 3; + optional int32 onDemandMsgCount = 4; + optional int64 oldestMsgTimestampMs = 5; + } + optional PeerDataOperationRequestType peerDataOperationRequestType = 1; repeated RequestStickerReupload requestStickerReupload = 2; repeated RequestUrlPreview requestUrlPreview = 3; + optional HistorySyncOnDemandRequest historySyncOnDemandRequest = 4; } message PaymentInviteMessage { @@ -376,6 +362,7 @@ message HistorySyncNotification { RECENT = 3; PUSH_NAME = 4; NON_BLOCKING_DATA = 5; + ON_DEMAND = 6; } optional bytes fileSha256 = 1; optional uint64 fileLength = 2; @@ -485,6 +472,11 @@ message ExtendedTextMessage { BRYNDAN_WRITE = 3; BEBASNEUE_REGULAR = 4; OSWALD_HEAVY = 5; + DAMION_REGULAR = 6; + MORNINGBREEZE_REGULAR = 7; + CALISTOGA_REGULAR = 8; + EXO2_EXTRABOLD = 9; + COURIERPRIME_BOLD = 10; } optional string text = 1; optional string matchedText = 2; @@ -652,6 +644,7 @@ message AudioMessage { optional bytes streamingSidecar = 18; optional bytes waveform = 19; optional fixed32 backgroundArgb = 20; + optional bool viewOnce = 21; } message AppStateSyncKey { @@ -730,6 +723,11 @@ message HydratedTemplateButton { } } +message GroupMention { + optional string groupJid = 1; + optional string groupSubject = 2; +} + message DisappearingMode { enum Initiator { CHANGED_IN_CHAT = 0; @@ -749,6 +747,11 @@ message DeviceListMetadata { } message ContextInfo { + message UTMInfo { + optional string utmSource = 1; + optional string utmCampaign = 2; + } + message ExternalAdReplyInfo { enum MediaType { NONE = 0; @@ -808,6 +811,8 @@ message ContextInfo { optional string trustBannerType = 37; optional uint32 trustBannerAction = 38; optional bool isSampled = 39; + repeated GroupMention groupMentions = 40; + optional UTMInfo utm = 41; } message ActionLink { @@ -928,6 +933,12 @@ message Message { optional FutureProofMessage editedMessage = 58; optional FutureProofMessage viewOnceMessageV2Extension = 59; optional PollCreationMessage pollCreationMessageV2 = 60; + optional ScheduledCallCreationMessage scheduledCallCreationMessage = 61; + optional FutureProofMessage groupMentionedMessage = 62; + optional PinMessage pinMessage = 63; + optional PollCreationMessage pollCreationMessageV3 = 64; + optional ScheduledCallEditMessage scheduledCallEditMessage = 65; + optional VideoMessage ptvMessage = 66; } message MessageContextInfo { @@ -1050,6 +1061,26 @@ message SendPaymentMessage { optional PaymentBackground background = 4; } +message ScheduledCallEditMessage { + enum EditType { + UNKNOWN = 0; + CANCEL = 1; + } + optional MessageKey key = 1; + optional EditType editType = 2; +} + +message ScheduledCallCreationMessage { + enum CallType { + UNKNOWN = 0; + VOICE = 1; + VIDEO = 2; + } + optional int64 scheduledTimestampMs = 1; + optional CallType callType = 2; + optional string title = 3; +} + message RequestPhoneNumberMessage { optional ContextInfo contextInfo = 1; } @@ -1163,6 +1194,45 @@ message PollCreationMessage { optional ContextInfo contextInfo = 5; } +message PinMessage { + enum PinMessageType { + UNKNOWN_PIN_MESSAGE_TYPE = 0; + PIN_FOR_ALL = 1; + UNPIN_FOR_ALL = 2; + } + optional MessageKey key = 1; + optional PinMessageType pinMessageType = 2; + optional int64 senderTimestampMs = 3; +} + +enum PeerDataOperationRequestType { + UPLOAD_STICKER = 0; + SEND_RECENT_STICKER_BOOTSTRAP = 1; + GENERATE_LINK_PREVIEW = 2; + HISTORY_SYNC_ON_DEMAND = 3; +} +message PeerDataOperationRequestResponseMessage { + message PeerDataOperationResult { + message LinkPreviewResponse { + optional string url = 1; + optional string title = 2; + optional string description = 3; + optional bytes thumbData = 4; + optional string canonicalUrl = 5; + optional string matchText = 6; + optional string previewType = 7; + } + + optional MediaRetryNotification.ResultType mediaUploadResult = 1; + optional StickerMessage stickerMessage = 2; + optional LinkPreviewResponse linkPreviewResponse = 3; + } + + optional PeerDataOperationRequestType peerDataOperationRequestType = 1; + optional string stanzaId = 2; + repeated PeerDataOperationResult peerDataOperationResult = 3; +} + message EphemeralSetting { optional sfixed32 duration = 1; optional sfixed64 timestamp = 2; @@ -1220,6 +1290,7 @@ message HistorySync { RECENT = 3; PUSH_NAME = 4; NON_BLOCKING_DATA = 5; + ON_DEMAND = 6; } required HistorySyncType syncType = 1; repeated Conversation conversations = 2; @@ -1303,8 +1374,8 @@ message Conversation { optional string description = 33; optional bool support = 34; optional bool isParentGroup = 35; - optional bool isDefaultSubgroup = 36; optional string parentGroupId = 37; + optional bool isDefaultSubgroup = 36; optional string displayName = 38; optional string pnJid = 39; optional bool shareOwnPn = 40; @@ -1831,6 +1902,7 @@ message ClientPayload { WEAROS = 29; ARDEVICE = 30; VRDEVICE = 31; + BLUE_WEB = 32; } message AppVersion { optional uint32 primary = 1; @@ -1912,11 +1984,6 @@ message ClientPayload { NETWORK_SWITCH = 4; PING_RECONNECT = 5; } - enum BizMarketSegment { - DEFAULT = 0; - DEVX = 1; - INBOX = 2; - } optional uint64 username = 1; optional bool passive = 3; optional UserAgent userAgent = 5; @@ -1941,7 +2008,6 @@ message ClientPayload { optional bytes fbDeviceId = 32; optional bool pull = 33; optional bytes paddingBytes = 34; - optional BizMarketSegment bizMarketSegment = 35; optional int32 yearClass = 36; optional int32 memClass = 37; } @@ -2258,6 +2324,7 @@ message PollUpdate { optional PollVoteMessage vote = 2; optional int64 senderTimestampMs = 3; optional int64 serverTimestampMs = 4; + optional bool unread = 5; } message PollAdditionalMetadata { diff --git a/vendor/go.mau.fi/whatsmeow/broadcast.go b/vendor/go.mau.fi/whatsmeow/broadcast.go index a61ccfb6..d3bbf8e6 100644 --- a/vendor/go.mau.fi/whatsmeow/broadcast.go +++ b/vendor/go.mau.fi/whatsmeow/broadcast.go @@ -30,14 +30,19 @@ func (cli *Client) getBroadcastListParticipants(jid types.JID) ([]types.JID, err return nil, ErrNotLoggedIn } - var hasSelf bool - for _, participant := range list { + selfIndex := -1 + for i, participant := range list { if participant.User == ownID.User { - hasSelf = true + selfIndex = i break } } - if !hasSelf { + if selfIndex >= 0 { + if cli.DontSendSelfBroadcast { + list[selfIndex] = list[len(list)-1] + list = list[:len(list)-1] + } + } else if !cli.DontSendSelfBroadcast { list = append(list, ownID) } return list, nil diff --git a/vendor/go.mau.fi/whatsmeow/client.go b/vendor/go.mau.fi/whatsmeow/client.go index 3f832c94..86581198 100644 --- a/vendor/go.mau.fi/whatsmeow/client.go +++ b/vendor/go.mau.fi/whatsmeow/client.go @@ -123,6 +123,10 @@ type Client struct { // If false, decrypting a message from untrusted devices will fail. AutoTrustIdentity bool + // Should sending to own devices be skipped when sending broadcasts? + // This works around a bug in the WhatsApp android app where it crashes if you send a status message from a linked device. + DontSendSelfBroadcast bool + // Should SubscribePresence return an error if no privacy token is stored for the user? ErrorOnSubscribePresenceWithoutToken bool @@ -186,8 +190,9 @@ func NewClient(deviceStore *store.Device, log waLog.Logger) *Client { GetMessageForRetry: func(requester, to types.JID, id types.MessageID) *waProto.Message { return nil }, appStateKeyRequests: make(map[string]time.Time), - EnableAutoReconnect: true, - AutoTrustIdentity: true, + EnableAutoReconnect: true, + AutoTrustIdentity: true, + DontSendSelfBroadcast: true, } cli.nodeHandlers = map[string]nodeHandler{ "message": cli.handleEncryptedMessage, diff --git a/vendor/go.mau.fi/whatsmeow/connectionevents.go b/vendor/go.mau.fi/whatsmeow/connectionevents.go index 5d0835fa..3a6d9e29 100644 --- a/vendor/go.mau.fi/whatsmeow/connectionevents.go +++ b/vendor/go.mau.fi/whatsmeow/connectionevents.go @@ -79,7 +79,10 @@ func (cli *Client) handleIB(node *waBinary.Node) { func (cli *Client) handleConnectFailure(node *waBinary.Node) { ag := node.AttrGetter() reason := events.ConnectFailureReason(ag.Int("reason")) - cli.expectDisconnect() + // Let the auto-reconnect happen for 503s, for all other failures block it + if reason != events.ConnectFailureServiceUnavailable { + cli.expectDisconnect() + } if reason.IsLoggedOut() { cli.Log.Infof("Got %s connect failure, sending LoggedOut event and deleting session", reason) go cli.dispatchEvent(&events.LoggedOut{OnConnect: true, Reason: reason}) @@ -96,6 +99,8 @@ func (cli *Client) handleConnectFailure(node *waBinary.Node) { } else if reason == events.ConnectFailureClientOutdated { cli.Log.Errorf("Client outdated (405) connect failure") go cli.dispatchEvent(&events.ClientOutdated{}) + } else if reason == events.ConnectFailureServiceUnavailable { + cli.Log.Warnf("Got 503 connect failure, assuming automatic reconnect will handle it") } else { cli.Log.Warnf("Unknown connect failure: %s", node.XMLString()) go cli.dispatchEvent(&events.ConnectFailure{Reason: reason, Raw: node}) diff --git a/vendor/go.mau.fi/whatsmeow/download.go b/vendor/go.mau.fi/whatsmeow/download.go index 99fd3648..e9bedd45 100644 --- a/vendor/go.mau.fi/whatsmeow/download.go +++ b/vendor/go.mau.fi/whatsmeow/download.go @@ -192,10 +192,10 @@ func (cli *Client) Download(msg DownloadableMessage) ([]byte, error) { var isWebWhatsappNetURL bool if ok { url = urlable.GetUrl() - isWebWhatsappNetURL = strings.HasPrefix(urlable.GetUrl(), "https://web.whatsapp.net") + isWebWhatsappNetURL = strings.HasPrefix(url, "https://web.whatsapp.net") } if len(url) > 0 && !isWebWhatsappNetURL { - return cli.downloadAndDecrypt(urlable.GetUrl(), msg.GetMediaKey(), mediaType, getSize(msg), msg.GetFileEncSha256(), msg.GetFileSha256()) + return cli.downloadAndDecrypt(url, msg.GetMediaKey(), mediaType, getSize(msg), msg.GetFileEncSha256(), msg.GetFileSha256()) } else if len(msg.GetDirectPath()) > 0 { return cli.DownloadMediaWithPath(msg.GetDirectPath(), msg.GetFileEncSha256(), msg.GetFileSha256(), msg.GetMediaKey(), getSize(msg), mediaType, mediaTypeToMMSType[mediaType]) } else { diff --git a/vendor/go.mau.fi/whatsmeow/message.go b/vendor/go.mau.fi/whatsmeow/message.go index 2c6c2db2..b3ef53b6 100644 --- a/vendor/go.mau.fi/whatsmeow/message.go +++ b/vendor/go.mau.fi/whatsmeow/message.go @@ -345,7 +345,7 @@ func (cli *Client) handleAppStateSyncKeyShare(keys *waProto.AppStateSyncKeyShare cli.Log.Errorf("Failed to store app state sync key %X: %v", key.GetKeyId().GetKeyId(), err) continue } - cli.Log.Debugf("Received app state sync key %X", key.GetKeyId().GetKeyId()) + cli.Log.Debugf("Received app state sync key %X (ts: %d)", key.GetKeyId().GetKeyId(), key.GetKeyData().GetTimestamp()) } cli.appStateKeyRequestsLock.RUnlock() diff --git a/vendor/go.mau.fi/whatsmeow/store/clientpayload.go b/vendor/go.mau.fi/whatsmeow/store/clientpayload.go index 08a3d280..9e8b1778 100644 --- a/vendor/go.mau.fi/whatsmeow/store/clientpayload.go +++ b/vendor/go.mau.fi/whatsmeow/store/clientpayload.go @@ -74,7 +74,7 @@ func (vc WAVersionContainer) ProtoAppVersion() *waProto.ClientPayload_UserAgent_ } // waVersion is the WhatsApp web client version -var waVersion = WAVersionContainer{2, 2301, 6} +var waVersion = WAVersionContainer{2, 2310, 5} // waVersionHash is the md5 hash of a dot-separated waVersion var waVersionHash [16]byte diff --git a/vendor/go.mau.fi/whatsmeow/store/sqlstore/store.go b/vendor/go.mau.fi/whatsmeow/store/sqlstore/store.go index 8221a4ad..f9f5a287 100644 --- a/vendor/go.mau.fi/whatsmeow/store/sqlstore/store.go +++ b/vendor/go.mau.fi/whatsmeow/store/sqlstore/store.go @@ -282,6 +282,7 @@ const ( INSERT INTO whatsmeow_app_state_sync_keys (jid, key_id, key_data, timestamp, fingerprint) VALUES ($1, $2, $3, $4, $5) ON CONFLICT (jid, key_id) DO UPDATE SET key_data=excluded.key_data, timestamp=excluded.timestamp, fingerprint=excluded.fingerprint + WHERE excluded.timestamp > whatsmeow_app_state_sync_keys.timestamp ` getAppStateSyncKeyQuery = `SELECT key_data, timestamp, fingerprint FROM whatsmeow_app_state_sync_keys WHERE jid=$1 AND key_id=$2` ) diff --git a/vendor/go.mau.fi/whatsmeow/types/events/events.go b/vendor/go.mau.fi/whatsmeow/types/events/events.go index dc8e0ada..4ec38d20 100644 --- a/vendor/go.mau.fi/whatsmeow/types/events/events.go +++ b/vendor/go.mau.fi/whatsmeow/types/events/events.go @@ -142,6 +142,11 @@ const ( ConnectFailureBadUserAgent ConnectFailureReason = 409 // 400, 500 and 501 are also existing codes, but the meaning is unknown + + // 503 doesn't seem to be included in the web app JS with the other codes, and it's very rare, + // but does happen after a 503 stream error sometimes. + + ConnectFailureServiceUnavailable ConnectFailureReason = 503 ) var connectFailureReasonMessage = map[ConnectFailureReason]string{ diff --git a/vendor/go.mau.fi/whatsmeow/types/jid.go b/vendor/go.mau.fi/whatsmeow/types/jid.go index 4f54f03d..c3bd8a56 100644 --- a/vendor/go.mau.fi/whatsmeow/types/jid.go +++ b/vendor/go.mau.fi/whatsmeow/types/jid.go @@ -23,6 +23,7 @@ const ( GroupServer = "g.us" LegacyUserServer = "c.us" BroadcastServer = "broadcast" + HiddenUserServer = "lid" ) // Some JIDs that are contacted often. diff --git a/vendor/go.mau.fi/whatsmeow/user.go b/vendor/go.mau.fi/whatsmeow/user.go index dae86406..229dc4b8 100644 --- a/vendor/go.mau.fi/whatsmeow/user.go +++ b/vendor/go.mau.fi/whatsmeow/user.go @@ -286,6 +286,7 @@ func (cli *Client) GetProfilePictureInfo(jid types.JID, params *GetProfilePictur attrs := waBinary.Attrs{ "query": "url", } + var target, to types.JID if params == nil { params = &GetProfilePictureParams{} } @@ -297,27 +298,36 @@ func (cli *Client) GetProfilePictureInfo(jid types.JID, params *GetProfilePictur if params.ExistingID != "" { attrs["id"] = params.ExistingID } - var pictureContent []waBinary.Node + var expectWrapped bool + var content []waBinary.Node namespace := "w:profile:picture" if params.IsCommunity { + target = types.EmptyJID namespace = "w:g2" - pictureContent = []waBinary.Node{{ - Tag: "query_linked", - Attrs: waBinary.Attrs{ - "type": "parent_group", - "jid": jid, - }, + to = jid + attrs["parent_group_jid"] = jid + expectWrapped = true + content = []waBinary.Node{{ + Tag: "pictures", + Content: []waBinary.Node{{ + Tag: "picture", + Attrs: attrs, + }}, + }} + } else { + to = types.ServerJID + target = jid + content = []waBinary.Node{{ + Tag: "picture", + Attrs: attrs, }} } resp, err := cli.sendIQ(infoQuery{ Namespace: namespace, Type: "get", - To: jid, - Content: []waBinary.Node{{ - Tag: "picture", - Attrs: attrs, - Content: pictureContent, - }}, + To: to, + Target: target, + Content: content, }) if errors.Is(err, ErrIQNotAuthorized) { return nil, wrapIQError(ErrProfilePictureUnauthorized, err) @@ -326,6 +336,13 @@ func (cli *Client) GetProfilePictureInfo(jid types.JID, params *GetProfilePictur } else if err != nil { return nil, err } + if expectWrapped { + pics, ok := resp.GetOptionalChildByTag("pictures") + if !ok { + return nil, &ElementMissingError{Tag: "pictures", In: "response to profile picture query"} + } + resp = &pics + } picture, ok := resp.GetOptionalChildByTag("picture") if !ok { if params.ExistingID != "" { @@ -335,6 +352,9 @@ func (cli *Client) GetProfilePictureInfo(jid types.JID, params *GetProfilePictur } var info types.ProfilePictureInfo ag := picture.AttrGetter() + if ag.OptionalInt("status") == 304 { + return nil, nil + } info.ID = ag.String("id") info.URL = ag.String("url") info.Type = ag.String("type") diff --git a/vendor/golang.org/x/crypto/acme/rfc8555.go b/vendor/golang.org/x/crypto/acme/rfc8555.go index ee24dfde..3152e531 100644 --- a/vendor/golang.org/x/crypto/acme/rfc8555.go +++ b/vendor/golang.org/x/crypto/acme/rfc8555.go @@ -117,7 +117,7 @@ func (c *Client) updateRegRFC(ctx context.Context, a *Account) (*Account, error) return responseAccount(res) } -// getGegRFC is equivalent to c.GetReg but for CAs implementing RFC 8555. +// getRegRFC is equivalent to c.GetReg but for CAs implementing RFC 8555. // It expects c.Discover to have already been called. func (c *Client) getRegRFC(ctx context.Context) (*Account, error) { req := json.RawMessage(`{"onlyReturnExisting": true}`) diff --git a/vendor/golang.org/x/crypto/bcrypt/bcrypt.go b/vendor/golang.org/x/crypto/bcrypt/bcrypt.go index addf56b4..5577c0f9 100644 --- a/vendor/golang.org/x/crypto/bcrypt/bcrypt.go +++ b/vendor/golang.org/x/crypto/bcrypt/bcrypt.go @@ -82,11 +82,20 @@ type hashed struct { minor byte } +// ErrPasswordTooLong is returned when the password passed to +// GenerateFromPassword is too long (i.e. > 72 bytes). +var ErrPasswordTooLong = errors.New("bcrypt: password length exceeds 72 bytes") + // GenerateFromPassword returns the bcrypt hash of the password at the given // cost. If the cost given is less than MinCost, the cost will be set to // DefaultCost, instead. Use CompareHashAndPassword, as defined in this package, // to compare the returned hashed password with its cleartext version. +// GenerateFromPassword does not accept passwords longer than 72 bytes, which +// is the longest password bcrypt will operate on. func GenerateFromPassword(password []byte, cost int) ([]byte, error) { + if len(password) > 72 { + return nil, ErrPasswordTooLong + } p, err := newFromPassword(password, cost) if err != nil { return nil, err diff --git a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go index 7b5b78cb..2671217d 100644 --- a/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go +++ b/vendor/golang.org/x/crypto/curve25519/internal/field/fe_generic.go @@ -245,7 +245,7 @@ func feSquareGeneric(v, a *Element) { v.carryPropagate() } -// carryPropagate brings the limbs below 52 bits by applying the reduction +// carryPropagateGeneric brings the limbs below 52 bits by applying the reduction // identity (a * 2²⁵⁵ + b = a * 19 + b) to the l4 carry. TODO inline func (v *Element) carryPropagateGeneric() *Element { c0 := v.l0 >> 51 diff --git a/vendor/golang.org/x/crypto/ssh/handshake.go b/vendor/golang.org/x/crypto/ssh/handshake.go index 2b84c357..07a1843e 100644 --- a/vendor/golang.org/x/crypto/ssh/handshake.go +++ b/vendor/golang.org/x/crypto/ssh/handshake.go @@ -58,11 +58,13 @@ type handshakeTransport struct { incoming chan []byte readError error - mu sync.Mutex - writeError error - sentInitPacket []byte - sentInitMsg *kexInitMsg - pendingPackets [][]byte // Used when a key exchange is in progress. + mu sync.Mutex + writeError error + sentInitPacket []byte + sentInitMsg *kexInitMsg + pendingPackets [][]byte // Used when a key exchange is in progress. + writePacketsLeft uint32 + writeBytesLeft int64 // If the read loop wants to schedule a kex, it pings this // channel, and the write loop will send out a kex @@ -71,7 +73,8 @@ type handshakeTransport struct { // If the other side requests or confirms a kex, its kexInit // packet is sent here for the write loop to find it. - startKex chan *pendingKex + startKex chan *pendingKex + kexLoopDone chan struct{} // closed (with writeError non-nil) when kexLoop exits // data for host key checking hostKeyCallback HostKeyCallback @@ -86,12 +89,10 @@ type handshakeTransport struct { // Algorithms agreed in the last key exchange. algorithms *algorithms + // Counters exclusively owned by readLoop. readPacketsLeft uint32 readBytesLeft int64 - writePacketsLeft uint32 - writeBytesLeft int64 - // The session ID or nil if first kex did not complete yet. sessionID []byte } @@ -108,7 +109,8 @@ func newHandshakeTransport(conn keyingTransport, config *Config, clientVersion, clientVersion: clientVersion, incoming: make(chan []byte, chanSize), requestKex: make(chan struct{}, 1), - startKex: make(chan *pendingKex, 1), + startKex: make(chan *pendingKex), + kexLoopDone: make(chan struct{}), config: config, } @@ -340,16 +342,17 @@ write: t.mu.Unlock() } - // drain startKex channel. We don't service t.requestKex - // because nobody does blocking sends there. - go func() { - for init := range t.startKex { - init.done <- t.writeError - } - }() - // Unblock reader. t.conn.Close() + + // drain startKex channel. We don't service t.requestKex + // because nobody does blocking sends there. + for request := range t.startKex { + request.done <- t.getWriteError() + } + + // Mark that the loop is done so that Close can return. + close(t.kexLoopDone) } // The protocol uses uint32 for packet counters, so we can't let them @@ -545,7 +548,16 @@ func (t *handshakeTransport) writePacket(p []byte) error { } func (t *handshakeTransport) Close() error { - return t.conn.Close() + // Close the connection. This should cause the readLoop goroutine to wake up + // and close t.startKex, which will shut down kexLoop if running. + err := t.conn.Close() + + // Wait for the kexLoop goroutine to complete. + // At that point we know that the readLoop goroutine is complete too, + // because kexLoop itself waits for readLoop to close the startKex channel. + <-t.kexLoopDone + + return err } func (t *handshakeTransport) enterKeyExchange(otherInitPacket []byte) error { diff --git a/vendor/golang.org/x/net/context/ctxhttp/ctxhttp.go b/vendor/golang.org/x/net/context/ctxhttp/ctxhttp.go deleted file mode 100644 index 37dc0cfd..00000000 --- a/vendor/golang.org/x/net/context/ctxhttp/ctxhttp.go +++ /dev/null @@ -1,71 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package ctxhttp provides helper functions for performing context-aware HTTP requests. -package ctxhttp // import "golang.org/x/net/context/ctxhttp" - -import ( - "context" - "io" - "net/http" - "net/url" - "strings" -) - -// Do sends an HTTP request with the provided http.Client and returns -// an HTTP response. -// -// If the client is nil, http.DefaultClient is used. -// -// The provided ctx must be non-nil. If it is canceled or times out, -// ctx.Err() will be returned. -func Do(ctx context.Context, client *http.Client, req *http.Request) (*http.Response, error) { - if client == nil { - client = http.DefaultClient - } - resp, err := client.Do(req.WithContext(ctx)) - // If we got an error, and the context has been canceled, - // the context's error is probably more useful. - if err != nil { - select { - case <-ctx.Done(): - err = ctx.Err() - default: - } - } - return resp, err -} - -// Get issues a GET request via the Do function. -func Get(ctx context.Context, client *http.Client, url string) (*http.Response, error) { - req, err := http.NewRequest("GET", url, nil) - if err != nil { - return nil, err - } - return Do(ctx, client, req) -} - -// Head issues a HEAD request via the Do function. -func Head(ctx context.Context, client *http.Client, url string) (*http.Response, error) { - req, err := http.NewRequest("HEAD", url, nil) - if err != nil { - return nil, err - } - return Do(ctx, client, req) -} - -// Post issues a POST request via the Do function. -func Post(ctx context.Context, client *http.Client, url string, bodyType string, body io.Reader) (*http.Response, error) { - req, err := http.NewRequest("POST", url, body) - if err != nil { - return nil, err - } - req.Header.Set("Content-Type", bodyType) - return Do(ctx, client, req) -} - -// PostForm issues a POST request via the Do function. -func PostForm(ctx context.Context, client *http.Client, url string, data url.Values) (*http.Response, error) { - return Post(ctx, client, url, "application/x-www-form-urlencoded", strings.NewReader(data.Encode())) -} diff --git a/vendor/golang.org/x/net/html/doc.go b/vendor/golang.org/x/net/html/doc.go index 822ed42a..7a96eae3 100644 --- a/vendor/golang.org/x/net/html/doc.go +++ b/vendor/golang.org/x/net/html/doc.go @@ -92,6 +92,21 @@ example, to process each anchor node in depth-first order: The relevant specifications include: https://html.spec.whatwg.org/multipage/syntax.html and https://html.spec.whatwg.org/multipage/syntax.html#tokenization + +# Security Considerations + +Care should be taken when parsing and interpreting HTML, whether full documents +or fragments, within the framework of the HTML specification, especially with +regard to untrusted inputs. + +This package provides both a tokenizer and a parser. Only the parser constructs +a DOM according to the HTML specification, resolving malformed and misplaced +tags where appropriate. The tokenizer simply tokenizes the HTML presented to it, +and as such does not resolve issues that may exist in the processed HTML, +producing a literal interpretation of the input. + +If your use case requires semantically well-formed HTML, as defined by the +WHATWG specifiction, the parser should be used rather than the tokenizer. */ package html // import "golang.org/x/net/html" diff --git a/vendor/golang.org/x/net/html/escape.go b/vendor/golang.org/x/net/html/escape.go index d8561396..04c6bec2 100644 --- a/vendor/golang.org/x/net/html/escape.go +++ b/vendor/golang.org/x/net/html/escape.go @@ -193,6 +193,87 @@ func lower(b []byte) []byte { return b } +// escapeComment is like func escape but escapes its input bytes less often. +// Per https://github.com/golang/go/issues/58246 some HTML comments are (1) +// meaningful and (2) contain angle brackets that we'd like to avoid escaping +// unless we have to. +// +// "We have to" includes the '&' byte, since that introduces other escapes. +// +// It also includes those bytes (not including EOF) that would otherwise end +// the comment. Per the summary table at the bottom of comment_test.go, this is +// the '>' byte that, per above, we'd like to avoid escaping unless we have to. +// +// Studying the summary table (and T actions in its '>' column) closely, we +// only need to escape in states 43, 44, 49, 51 and 52. State 43 is at the +// start of the comment data. State 52 is after a '!'. The other three states +// are after a '-'. +// +// Our algorithm is thus to escape every '&' and to escape '>' if and only if: +// - The '>' is after a '!' or '-' (in the unescaped data) or +// - The '>' is at the start of the comment data (after the opening ""); err != nil { diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index ae24a6fd..5c2a1f4e 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -110,7 +110,7 @@ func (t Token) String() string { case SelfClosingTagToken: return "<" + t.tagString() + "/>" case CommentToken: - return "" + return "" case DoctypeToken: return "" } @@ -598,6 +598,11 @@ scriptDataDoubleEscapeEnd: // readComment reads the next comment token starting with "") return + } else if c == '-' { + dashCount = 1 + beginning = false + continue } } } @@ -645,6 +649,35 @@ func (z *Tokenizer) readComment() { } } +func (z *Tokenizer) calculateAbruptCommentDataEnd() int { + raw := z.Raw() + const prefixLen = len("