lug/matterbridge
10
0
Fork 2
Code Issues 3 Pull Requests Actions 1 Packages Projects Releases Wiki Activity

feat: Waku v2 bridge

Browse Source 
Issue #12610
This commit is contained in:
Michal Iskierko
2023-11-12 13:29:38 +01:00
parent 56e7bd01ca
commit 6d31343205
6716 changed files with 1982502 additions and 5891 deletions
Download Patch File Download Diff File Expand all files Collapse all files

18
vendor/github.com/klauspost/cpuid/v2/README.md generated vendored
View File

@@ -19,6 +19,12 @@ Package home: https://github.com/klauspost/cpuid
`go get -u github.com/klauspost/cpuid/v2` using modules.
Drop `v2` for others.
Installing binary:
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
### Homebrew
For macOS/Linux users, you can install via [brew](https://brew.sh/)
@@ -302,6 +308,7 @@ Exit Code 1
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
| BMI1 | Bit Manipulation Instruction Set 1 |
| BMI2 | Bit Manipulation Instruction Set 2 |
| CETIBT | Intel CET Indirect Branch Tracking |
@@ -355,6 +362,7 @@ Exit Code 1
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
| IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
| LAHF | LAHF/SAHF in long mode |
@@ -372,8 +380,9 @@ Exit Code 1
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available |
| NRIPS | Indicates support for NRIP save on VMEXIT |
| NX | NX (No-Execute) bit |
@@ -381,12 +390,13 @@ Exit Code 1
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
| POPCNT | POPCNT instruction |
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
| PREFETCHI | PREFETCHIT0/1 instructions |
| PSFD | AMD: Predictive Store Forward Disable |
| PREFETCHI | PREFETCHIT0/1 instructions |
| PSFD | Predictive Store Forward Disable |
| RDPRU | RDPRU instruction supported |
| RDRAND | RDRAND instruction is available |
| RDSEED | RDSEED instruction is available |
| RDTSCP | RDTSCP Instruction |
| RRSBA_CTRL | Restricted RSB Alternate |
| RTM | Restricted Transactional Memory |
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
| SERIALIZE | Serialize Instruction Execution |
@@ -425,6 +435,7 @@ Exit Code 1
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
| TDX_GUEST | Intel Trust Domain Extensions Guest |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
@@ -439,6 +450,7 @@ Exit Code 1
| VTE | AMD Virtual Transparent Encryption supported |
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
| WBNOINVD | Write Back and Do Not Invalidate Cache |
| WRMSRNS | Non-Serializing Write to Model Specific Register |
| X87 | FPU |
| XGETBV1 | Supports XGETBV with ECX = 1 |
| XOP | Bulldozer XOP functions |

34
vendor/github.com/klauspost/cpuid/v2/cpuid.go generated vendored
View File

@@ -99,6 +99,7 @@ const (
AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
AVXVNNIINT8 // AVX-VNNI-INT8 instructions
BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
BMI1 // Bit Manipulation Instruction Set 1
BMI2 // Bit Manipulation Instruction Set 2
CETIBT // Intel CET Indirect Branch Tracking
@@ -152,6 +153,7 @@ const (
IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
IBS_PREVENTHOST // Disallowing IBS use by the host supported
IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
IDPRED_CTRL // IPRED_DIS
INT_WBINVD // WBINVD/WBNOINVD are interruptible.
INVLPGB // NVLPGB and TLBSYNC instruction supported
LAHF // LAHF/SAHF in long mode
@@ -171,6 +173,7 @@ const (
MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
MPX // Intel MPX (Memory Protection Extensions)
MSRIRC // Instruction Retired Counter MSR available
MSRLIST // Read/Write List of Model Specific Registers
MSR_PAGEFLUSH // Page Flush MSR available
NRIPS // Indicates support for NRIP save on VMEXIT
NX // NX (No-Execute) bit
@@ -179,11 +182,12 @@ const (
POPCNT // POPCNT instruction
PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
PREFETCHI // PREFETCHIT0/1 instructions
PSFD // AMD: Predictive Store Forward Disable
PSFD // Predictive Store Forward Disable
RDPRU // RDPRU instruction supported
RDRAND // RDRAND instruction is available
RDSEED // RDSEED instruction is available
RDTSCP // RDTSCP Instruction
RRSBA_CTRL // Restricted RSB Alternate
RTM // Restricted Transactional Memory
RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
SERIALIZE // Serialize Instruction Execution
@@ -222,6 +226,7 @@ const (
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation
TDX_GUEST // Intel Trust Domain Extensions Guest
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
@@ -236,6 +241,7 @@ const (
VTE // AMD Virtual Transparent Encryption supported
WAITPKG // TPAUSE, UMONITOR, UMWAIT
WBNOINVD // Write Back and Do Not Invalidate Cache
WRMSRNS // Non-Serializing Write to Model Specific Register
X87 // FPU
XGETBV1 // Supports XGETBV with ECX = 1
XOP // Bulldozer XOP functions
@@ -1181,13 +1187,8 @@ func support() flagSet {
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx&(1<<14) != 0, PREFETCHI)
// CPUID.(EAX=7, ECX=1).EAX
eax1, _, _, _ := cpuidex(7, 1)
eax1, _, _, edx1 := cpuidex(7, 1)
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
@@ -1197,6 +1198,11 @@ func support() flagSet {
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
fs.setIf(eax1&(1<<26) != 0, LAM)
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
// Check for OS support
@@ -1232,13 +1238,20 @@ func support() flagSet {
fs.setIf(edx&(1<<25) != 0, AMXINT8)
// eax1 = CPUID.(EAX=7, ECX=1).EAX
fs.setIf(eax1&(1<<5) != 0, AVX512BF16)
fs.setIf(eax1&(1<<19) != 0, WRMSRNS)
fs.setIf(eax1&(1<<21) != 0, AMXFP16)
fs.setIf(eax1&(1<<27) != 0, MSRLIST)
}
}
// CPUID.(EAX=7, ECX=2)
_, _, _, edx = cpuidex(7, 2)
fs.setIf(edx&(1<<0) != 0, PSFD)
fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL)
fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL)
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
}
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
@@ -1381,6 +1394,13 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21)
identity := string(valAsString(ebx, edx, ecx))
fs.setIf(identity == "IntelTDX ", TDX_GUEST)
}
return fs
}

348
vendor/github.com/klauspost/cpuid/v2/featureid_string.go generated vendored
View File

@@ -39,181 +39,187 @@ func _() {
_ = x[AVXSLOW-29]
_ = x[AVXVNNI-30]
_ = x[AVXVNNIINT8-31]
_ = x[BMI1-32]
_ = x[BMI2-33]
_ = x[CETIBT-34]
_ = x[CETSS-35]
_ = x[CLDEMOTE-36]
_ = x[CLMUL-37]
_ = x[CLZERO-38]
_ = x[CMOV-39]
_ = x[CMPCCXADD-40]
_ = x[CMPSB_SCADBS_SHORT-41]
_ = x[CMPXCHG8-42]
_ = x[CPBOOST-43]
_ = x[CPPC-44]
_ = x[CX16-45]
_ = x[EFER_LMSLE_UNS-46]
_ = x[ENQCMD-47]
_ = x[ERMS-48]
_ = x[F16C-49]
_ = x[FLUSH_L1D-50]
_ = x[FMA3-51]
_ = x[FMA4-52]
_ = x[FP128-53]
_ = x[FP256-54]
_ = x[FSRM-55]
_ = x[FXSR-56]
_ = x[FXSROPT-57]
_ = x[GFNI-58]
_ = x[HLE-59]
_ = x[HRESET-60]
_ = x[HTT-61]
_ = x[HWA-62]
_ = x[HYBRID_CPU-63]
_ = x[HYPERVISOR-64]
_ = x[IA32_ARCH_CAP-65]
_ = x[IA32_CORE_CAP-66]
_ = x[IBPB-67]
_ = x[IBRS-68]
_ = x[IBRS_PREFERRED-69]
_ = x[IBRS_PROVIDES_SMP-70]
_ = x[IBS-71]
_ = x[IBSBRNTRGT-72]
_ = x[IBSFETCHSAM-73]
_ = x[IBSFFV-74]
_ = x[IBSOPCNT-75]
_ = x[IBSOPCNTEXT-76]
_ = x[IBSOPSAM-77]
_ = x[IBSRDWROPCNT-78]
_ = x[IBSRIPINVALIDCHK-79]
_ = x[IBS_FETCH_CTLX-80]
_ = x[IBS_OPDATA4-81]
_ = x[IBS_OPFUSE-82]
_ = x[IBS_PREVENTHOST-83]
_ = x[IBS_ZEN4-84]
_ = x[INT_WBINVD-85]
_ = x[INVLPGB-86]
_ = x[LAHF-87]
_ = x[LAM-88]
_ = x[LBRVIRT-89]
_ = x[LZCNT-90]
_ = x[MCAOVERFLOW-91]
_ = x[MCDT_NO-92]
_ = x[MCOMMIT-93]
_ = x[MD_CLEAR-94]
_ = x[MMX-95]
_ = x[MMXEXT-96]
_ = x[MOVBE-97]
_ = x[MOVDIR64B-98]
_ = x[MOVDIRI-99]
_ = x[MOVSB_ZL-100]
_ = x[MOVU-101]
_ = x[MPX-102]
_ = x[MSRIRC-103]
_ = x[MSR_PAGEFLUSH-104]
_ = x[NRIPS-105]
_ = x[NX-106]
_ = x[OSXSAVE-107]
_ = x[PCONFIG-108]
_ = x[POPCNT-109]
_ = x[PPIN-110]
_ = x[PREFETCHI-111]
_ = x[PSFD-112]
_ = x[RDPRU-113]
_ = x[RDRAND-114]
_ = x[RDSEED-115]
_ = x[RDTSCP-116]
_ = x[RTM-117]
_ = x[RTM_ALWAYS_ABORT-118]
_ = x[SERIALIZE-119]
_ = x[SEV-120]
_ = x[SEV_64BIT-121]
_ = x[SEV_ALTERNATIVE-122]
_ = x[SEV_DEBUGSWAP-123]
_ = x[SEV_ES-124]
_ = x[SEV_RESTRICTED-125]
_ = x[SEV_SNP-126]
_ = x[SGX-127]
_ = x[SGXLC-128]
_ = x[SHA-129]
_ = x[SME-130]
_ = x[SME_COHERENT-131]
_ = x[SPEC_CTRL_SSBD-132]
_ = x[SRBDS_CTRL-133]
_ = x[SSE-134]
_ = x[SSE2-135]
_ = x[SSE3-136]
_ = x[SSE4-137]
_ = x[SSE42-138]
_ = x[SSE4A-139]
_ = x[SSSE3-140]
_ = x[STIBP-141]
_ = x[STIBP_ALWAYSON-142]
_ = x[STOSB_SHORT-143]
_ = x[SUCCOR-144]
_ = x[SVM-145]
_ = x[SVMDA-146]
_ = x[SVMFBASID-147]
_ = x[SVML-148]
_ = x[SVMNP-149]
_ = x[SVMPF-150]
_ = x[SVMPFT-151]
_ = x[SYSCALL-152]
_ = x[SYSEE-153]
_ = x[TBM-154]
_ = x[TLB_FLUSH_NESTED-155]
_ = x[TME-156]
_ = x[TOPEXT-157]
_ = x[TSCRATEMSR-158]
_ = x[TSXLDTRK-159]
_ = x[VAES-160]
_ = x[VMCBCLEAN-161]
_ = x[VMPL-162]
_ = x[VMSA_REGPROT-163]
_ = x[VMX-164]
_ = x[VPCLMULQDQ-165]
_ = x[VTE-166]
_ = x[WAITPKG-167]
_ = x[WBNOINVD-168]
_ = x[X87-169]
_ = x[XGETBV1-170]
_ = x[XOP-171]
_ = x[XSAVE-172]
_ = x[XSAVEC-173]
_ = x[XSAVEOPT-174]
_ = x[XSAVES-175]
_ = x[AESARM-176]
_ = x[ARMCPUID-177]
_ = x[ASIMD-178]
_ = x[ASIMDDP-179]
_ = x[ASIMDHP-180]
_ = x[ASIMDRDM-181]
_ = x[ATOMICS-182]
_ = x[CRC32-183]
_ = x[DCPOP-184]
_ = x[EVTSTRM-185]
_ = x[FCMA-186]
_ = x[FP-187]
_ = x[FPHP-188]
_ = x[GPA-189]
_ = x[JSCVT-190]
_ = x[LRCPC-191]
_ = x[PMULL-192]
_ = x[SHA1-193]
_ = x[SHA2-194]
_ = x[SHA3-195]
_ = x[SHA512-196]
_ = x[SM3-197]
_ = x[SM4-198]
_ = x[SVE-199]
_ = x[lastID-200]
_ = x[BHI_CTRL-32]
_ = x[BMI1-33]
_ = x[BMI2-34]
_ = x[CETIBT-35]
_ = x[CETSS-36]
_ = x[CLDEMOTE-37]
_ = x[CLMUL-38]
_ = x[CLZERO-39]
_ = x[CMOV-40]
_ = x[CMPCCXADD-41]
_ = x[CMPSB_SCADBS_SHORT-42]
_ = x[CMPXCHG8-43]
_ = x[CPBOOST-44]
_ = x[CPPC-45]
_ = x[CX16-46]
_ = x[EFER_LMSLE_UNS-47]
_ = x[ENQCMD-48]
_ = x[ERMS-49]
_ = x[F16C-50]
_ = x[FLUSH_L1D-51]
_ = x[FMA3-52]
_ = x[FMA4-53]
_ = x[FP128-54]
_ = x[FP256-55]
_ = x[FSRM-56]
_ = x[FXSR-57]
_ = x[FXSROPT-58]
_ = x[GFNI-59]
_ = x[HLE-60]
_ = x[HRESET-61]
_ = x[HTT-62]
_ = x[HWA-63]
_ = x[HYBRID_CPU-64]
_ = x[HYPERVISOR-65]
_ = x[IA32_ARCH_CAP-66]
_ = x[IA32_CORE_CAP-67]
_ = x[IBPB-68]
_ = x[IBRS-69]
_ = x[IBRS_PREFERRED-70]
_ = x[IBRS_PROVIDES_SMP-71]
_ = x[IBS-72]
_ = x[IBSBRNTRGT-73]
_ = x[IBSFETCHSAM-74]
_ = x[IBSFFV-75]
_ = x[IBSOPCNT-76]
_ = x[IBSOPCNTEXT-77]
_ = x[IBSOPSAM-78]
_ = x[IBSRDWROPCNT-79]
_ = x[IBSRIPINVALIDCHK-80]
_ = x[IBS_FETCH_CTLX-81]
_ = x[IBS_OPDATA4-82]
_ = x[IBS_OPFUSE-83]
_ = x[IBS_PREVENTHOST-84]
_ = x[IBS_ZEN4-85]
_ = x[IDPRED_CTRL-86]
_ = x[INT_WBINVD-87]
_ = x[INVLPGB-88]
_ = x[LAHF-89]
_ = x[LAM-90]
_ = x[LBRVIRT-91]
_ = x[LZCNT-92]
_ = x[MCAOVERFLOW-93]
_ = x[MCDT_NO-94]
_ = x[MCOMMIT-95]
_ = x[MD_CLEAR-96]
_ = x[MMX-97]
_ = x[MMXEXT-98]
_ = x[MOVBE-99]
_ = x[MOVDIR64B-100]
_ = x[MOVDIRI-101]
_ = x[MOVSB_ZL-102]
_ = x[MOVU-103]
_ = x[MPX-104]
_ = x[MSRIRC-105]
_ = x[MSRLIST-106]
_ = x[MSR_PAGEFLUSH-107]
_ = x[NRIPS-108]
_ = x[NX-109]
_ = x[OSXSAVE-110]
_ = x[PCONFIG-111]
_ = x[POPCNT-112]
_ = x[PPIN-113]
_ = x[PREFETCHI-114]
_ = x[PSFD-115]
_ = x[RDPRU-116]
_ = x[RDRAND-117]
_ = x[RDSEED-118]
_ = x[RDTSCP-119]
_ = x[RRSBA_CTRL-120]
_ = x[RTM-121]
_ = x[RTM_ALWAYS_ABORT-122]
_ = x[SERIALIZE-123]
_ = x[SEV-124]
_ = x[SEV_64BIT-125]
_ = x[SEV_ALTERNATIVE-126]
_ = x[SEV_DEBUGSWAP-127]
_ = x[SEV_ES-128]
_ = x[SEV_RESTRICTED-129]
_ = x[SEV_SNP-130]
_ = x[SGX-131]
_ = x[SGXLC-132]
_ = x[SHA-133]
_ = x[SME-134]
_ = x[SME_COHERENT-135]
_ = x[SPEC_CTRL_SSBD-136]
_ = x[SRBDS_CTRL-137]
_ = x[SSE-138]
_ = x[SSE2-139]
_ = x[SSE3-140]
_ = x[SSE4-141]
_ = x[SSE42-142]
_ = x[SSE4A-143]
_ = x[SSSE3-144]
_ = x[STIBP-145]
_ = x[STIBP_ALWAYSON-146]
_ = x[STOSB_SHORT-147]
_ = x[SUCCOR-148]
_ = x[SVM-149]
_ = x[SVMDA-150]
_ = x[SVMFBASID-151]
_ = x[SVML-152]
_ = x[SVMNP-153]
_ = x[SVMPF-154]
_ = x[SVMPFT-155]
_ = x[SYSCALL-156]
_ = x[SYSEE-157]
_ = x[TBM-158]
_ = x[TDX_GUEST-159]
_ = x[TLB_FLUSH_NESTED-160]
_ = x[TME-161]
_ = x[TOPEXT-162]
_ = x[TSCRATEMSR-163]
_ = x[TSXLDTRK-164]
_ = x[VAES-165]
_ = x[VMCBCLEAN-166]
_ = x[VMPL-167]
_ = x[VMSA_REGPROT-168]
_ = x[VMX-169]
_ = x[VPCLMULQDQ-170]
_ = x[VTE-171]
_ = x[WAITPKG-172]
_ = x[WBNOINVD-173]
_ = x[WRMSRNS-174]
_ = x[X87-175]
_ = x[XGETBV1-176]
_ = x[XOP-177]
_ = x[XSAVE-178]
_ = x[XSAVEC-179]
_ = x[XSAVEOPT-180]
_ = x[XSAVES-181]
_ = x[AESARM-182]
_ = x[ARMCPUID-183]
_ = x[ASIMD-184]
_ = x[ASIMDDP-185]
_ = x[ASIMDHP-186]
_ = x[ASIMDRDM-187]
_ = x[ATOMICS-188]
_ = x[CRC32-189]
_ = x[DCPOP-190]
_ = x[EVTSTRM-191]
_ = x[FCMA-192]
_ = x[FP-193]
_ = x[FPHP-194]
_ = x[GPA-195]
_ = x[JSCVT-196]
_ = x[LRCPC-197]
_ = x[PMULL-198]
_ = x[SHA1-199]
_ = x[SHA2-200]
_ = x[SHA3-201]
_ = x[SHA512-202]
_ = x[SM3-203]
_ = x[SM4-204]
_ = x[SVE-205]
_ = x[lastID-206]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4INT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 278, 282, 288, 293, 301, 306, 312, 316, 325, 343, 351, 358, 362, 366, 380, 386, 390, 394, 403, 407, 411, 416, 421, 425, 429, 436, 440, 443, 449, 452, 455, 465, 475, 488, 501, 505, 509, 523, 540, 543, 553, 564, 570, 578, 589, 597, 609, 625, 639, 650, 660, 675, 683, 693, 700, 704, 707, 714, 719, 730, 737, 744, 752, 755, 761, 766, 775, 782, 790, 794, 797, 803, 816, 821, 823, 830, 837, 843, 847, 856, 860, 865, 871, 877, 883, 886, 902, 911, 914, 923, 938, 951, 957, 971, 978, 981, 986, 989, 992, 1004, 1018, 1028, 1031, 1035, 1039, 1043, 1048, 1053, 1058, 1063, 1077, 1088, 1094, 1097, 1102, 1111, 1115, 1120, 1125, 1131, 1138, 1143, 1146, 1162, 1165, 1171, 1181, 1189, 1193, 1202, 1206, 1218, 1221, 1231, 1234, 1241, 1249, 1252, 1259, 1262, 1267, 1273, 1281, 1287, 1293, 1301, 1306, 1313, 1320, 1328, 1335, 1340, 1345, 1352, 1356, 1358, 1362, 1365, 1370, 1375, 1380, 1384, 1388, 1392, 1398, 1401, 1404, 1407, 1413}
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {